SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1eavA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1eavA
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.61e-66
Family MogA-like 0.0000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1eavA   PDB: 1eav   SUPERFAMILY: 1eavA
Sequence length 162
Comment (A:)
Sequence
vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqi
Download sequence
Identical sequences 1eav_A 1eav_B 1eav_C 1eav_D 1eav_E 1eav_F 1eav_G 1eav_H 1eavA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]