SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1g8lA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1g8lA
Domain Number 1 Region: 7-177
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 3.37e-59
Family MoeA N-terminal region -like 0.0000000172
Further Details:      
 
Domain Number 2 Region: 178-317
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 3.66e-50
Family MoeA central domain-like 0.000000304
Further Details:      
 
Domain Number 3 Region: 328-407
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 5.27e-25
Family MoeA C-terminal domain-like 0.00000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1g8lA   PDB: 1g8l
Sequence length 411
Comment (A:)
Sequence
MEFTTGLMSLDTALNEMLSRVTPLTAQETLPLVQCFGRILASDVVSPLDVPGFDNSAMDG
YAVRLADIASGQPLPVAGKSFAGQPYHGEWPAGTCIRIMTGAPVPEGCEAVVMQEQTEQM
DNGVRFTAEVRSGQNIRRRGEDISAGAVVFPAGTRLTTAELPVIASLGIAEVPVIRKVRV
ALFSTGDELQLPGQPLGDGQIYDTNRLAVHLMLEQLGCEVINLGIIRDDPHALRAAFIEA
DSQADVVISSGGVSVGEADYTKTILEELGEIAFWKLAIKPGKPFAFGKLSNSWFCGLPGN
PVSATLTFYQLVQPLLAKLSGNTASGLPARQRVRTASRLKKTPGRLDFQRGVLQRNADGE
LEVTTTGHQGSHIFSSFSLGNCFIVLERDRGNVEVGEWVEVEPFNALFGGL
Download sequence
Identical sequences A0A024L551 A0A069XWV4 A0A070VC88 A0A0E1LZJ2 A0A125X5I4 A0A1X3JK37 A0A236I6Z9 A0A238B888 E3PI57 F4SLL0 G0F376 H4UG70 I2XD84 M9H3P6 P12281
gi|170080486|ref|YP_001729806.1| gi|16128795|ref|NP_415348.1| gi|387620554|ref|YP_006128181.1| 1fc5_A 1fc5_B 1g8l_A 1g8l_B 1g8r_A 1g8r_B 316385.ECDH10B_0896 316407.moeA 511145.b0827 595496.BWG_0680 gi|387611369|ref|YP_006114485.1| APC135 MOEA_ECOLI 1g8lA gi|471332882|ref|YP_007556359.1| gi|388476912|ref|YP_489100.1| gi|238900086|ref|YP_002925882.1| gi|387620554|ref|YP_006128181.1| NP_415348.1.90541 WP_000397340.1.100085 WP_000397340.1.100111 WP_000397340.1.100441 WP_000397340.1.100487 WP_000397340.1.10051 WP_000397340.1.100824 WP_000397340.1.100966 WP_000397340.1.101033 WP_000397340.1.101158 WP_000397340.1.101186 WP_000397340.1.101282 WP_000397340.1.101423 WP_000397340.1.101654 WP_000397340.1.101737 WP_000397340.1.101747 WP_000397340.1.10188 WP_000397340.1.101908 WP_000397340.1.10235 WP_000397340.1.10252 WP_000397340.1.10304 WP_000397340.1.10417 WP_000397340.1.10491 WP_000397340.1.10496 WP_000397340.1.10729 WP_000397340.1.10833 WP_000397340.1.11047 WP_000397340.1.11118 WP_000397340.1.1113 WP_000397340.1.11408 WP_000397340.1.1168 WP_000397340.1.11844 WP_000397340.1.11955 WP_000397340.1.11982 WP_000397340.1.1212 WP_000397340.1.12415 WP_000397340.1.12458 WP_000397340.1.12542 WP_000397340.1.12558 WP_000397340.1.12582 WP_000397340.1.12680 WP_000397340.1.127 WP_000397340.1.12756 WP_000397340.1.12914 WP_000397340.1.13031 WP_000397340.1.1312 WP_000397340.1.13136 WP_000397340.1.13176 WP_000397340.1.13239 WP_000397340.1.13258 WP_000397340.1.13281 WP_000397340.1.13290 WP_000397340.1.13333 WP_000397340.1.1345 WP_000397340.1.13585 WP_000397340.1.13618 WP_000397340.1.13672 WP_000397340.1.13877 WP_000397340.1.13949 WP_000397340.1.14030 WP_000397340.1.1419 WP_000397340.1.14346 WP_000397340.1.1438 WP_000397340.1.14501 WP_000397340.1.14529 WP_000397340.1.1461 WP_000397340.1.14811 WP_000397340.1.14833 WP_000397340.1.14871 WP_000397340.1.14992 WP_000397340.1.1512 WP_000397340.1.15121 WP_000397340.1.15259 WP_000397340.1.15496 WP_000397340.1.15576 WP_000397340.1.15645 WP_000397340.1.15740 WP_000397340.1.15747 WP_000397340.1.1588 WP_000397340.1.16086 WP_000397340.1.1609 WP_000397340.1.16111 WP_000397340.1.16179 WP_000397340.1.16294 WP_000397340.1.1634 WP_000397340.1.16532 WP_000397340.1.16541 WP_000397340.1.16577 WP_000397340.1.16715 WP_000397340.1.16721 WP_000397340.1.16752 WP_000397340.1.17018 WP_000397340.1.17084 WP_000397340.1.17087 WP_000397340.1.17114 WP_000397340.1.17432 WP_000397340.1.17534 WP_000397340.1.1755 WP_000397340.1.17577 WP_000397340.1.17952 WP_000397340.1.18133 WP_000397340.1.18381 WP_000397340.1.18402 WP_000397340.1.18726 WP_000397340.1.18858 WP_000397340.1.18876 WP_000397340.1.19100 WP_000397340.1.19150 WP_000397340.1.19194 WP_000397340.1.19205 WP_000397340.1.19277 WP_000397340.1.193 WP_000397340.1.19313 WP_000397340.1.1982 WP_000397340.1.19889 WP_000397340.1.19940 WP_000397340.1.19957 WP_000397340.1.19994 WP_000397340.1.20151 WP_000397340.1.20318 WP_000397340.1.20445 WP_000397340.1.20506 WP_000397340.1.20536 WP_000397340.1.2063 WP_000397340.1.20638 WP_000397340.1.20724 WP_000397340.1.20737 WP_000397340.1.20982 WP_000397340.1.2100 WP_000397340.1.21020 WP_000397340.1.21033 WP_000397340.1.21057 WP_000397340.1.21122 WP_000397340.1.21251 WP_000397340.1.2142 WP_000397340.1.21470 WP_000397340.1.2156 WP_000397340.1.21573 WP_000397340.1.21661 WP_000397340.1.21733 WP_000397340.1.21758 WP_000397340.1.21771 WP_000397340.1.21823 WP_000397340.1.21915 WP_000397340.1.22060 WP_000397340.1.22113 WP_000397340.1.22314 WP_000397340.1.22363 WP_000397340.1.22450 WP_000397340.1.22574 WP_000397340.1.22632 WP_000397340.1.22669 WP_000397340.1.22690 WP_000397340.1.22830 WP_000397340.1.22878 WP_000397340.1.22885 WP_000397340.1.23044 WP_000397340.1.23090 WP_000397340.1.23378 WP_000397340.1.23511 WP_000397340.1.23549 WP_000397340.1.23812 WP_000397340.1.23898 WP_000397340.1.23945 WP_000397340.1.24045 WP_000397340.1.2418 WP_000397340.1.2428 WP_000397340.1.24304 WP_000397340.1.24362 WP_000397340.1.24583 WP_000397340.1.24616 WP_000397340.1.24899 WP_000397340.1.24960 WP_000397340.1.25085 WP_000397340.1.25141 WP_000397340.1.25203 WP_000397340.1.25324 WP_000397340.1.25525 WP_000397340.1.25643 WP_000397340.1.25713 WP_000397340.1.26048 WP_000397340.1.26379 WP_000397340.1.26480 WP_000397340.1.26609 WP_000397340.1.26941 WP_000397340.1.27098 WP_000397340.1.27134 WP_000397340.1.27451 WP_000397340.1.27560 WP_000397340.1.27742 WP_000397340.1.27879 WP_000397340.1.27923 WP_000397340.1.27971 WP_000397340.1.28128 WP_000397340.1.28268 WP_000397340.1.28271 WP_000397340.1.28371 WP_000397340.1.28509 WP_000397340.1.28662 WP_000397340.1.28697 WP_000397340.1.28711 WP_000397340.1.28809 WP_000397340.1.28919 WP_000397340.1.28982 WP_000397340.1.28994 WP_000397340.1.29061 WP_000397340.1.29128 WP_000397340.1.29221 WP_000397340.1.2945 WP_000397340.1.29746 WP_000397340.1.30231 WP_000397340.1.30247 WP_000397340.1.30472 WP_000397340.1.30479 WP_000397340.1.30497 WP_000397340.1.30630 WP_000397340.1.30749 WP_000397340.1.31211 WP_000397340.1.31379 WP_000397340.1.31407 WP_000397340.1.31614 WP_000397340.1.3169 WP_000397340.1.31833 WP_000397340.1.31839 WP_000397340.1.31978 WP_000397340.1.32093 WP_000397340.1.32121 WP_000397340.1.32127 WP_000397340.1.32143 WP_000397340.1.32479 WP_000397340.1.32509 WP_000397340.1.32903 WP_000397340.1.32984 WP_000397340.1.33244 WP_000397340.1.33325 WP_000397340.1.33408 WP_000397340.1.33424 WP_000397340.1.33502 WP_000397340.1.33526 WP_000397340.1.33545 WP_000397340.1.33565 WP_000397340.1.33648 WP_000397340.1.33736 WP_000397340.1.33746 WP_000397340.1.33799 WP_000397340.1.33879 WP_000397340.1.33888 WP_000397340.1.3401 WP_000397340.1.34124 WP_000397340.1.34332 WP_000397340.1.34363 WP_000397340.1.34444 WP_000397340.1.34525 WP_000397340.1.34532 WP_000397340.1.34538 WP_000397340.1.34990 WP_000397340.1.34993 WP_000397340.1.35204 WP_000397340.1.35360 WP_000397340.1.35466 WP_000397340.1.35651 WP_000397340.1.35724 WP_000397340.1.35904 WP_000397340.1.35959 WP_000397340.1.36164 WP_000397340.1.3620 WP_000397340.1.36334 WP_000397340.1.36386 WP_000397340.1.36453 WP_000397340.1.36627 WP_000397340.1.3671 WP_000397340.1.36746 WP_000397340.1.36747 WP_000397340.1.36833 WP_000397340.1.37122 WP_000397340.1.37233 WP_000397340.1.37261 WP_000397340.1.37433 WP_000397340.1.37485 WP_000397340.1.37576 WP_000397340.1.37588 WP_000397340.1.3788 WP_000397340.1.37897 WP_000397340.1.37964 WP_000397340.1.38085 WP_000397340.1.38105 WP_000397340.1.3811 WP_000397340.1.3815 WP_000397340.1.38182 WP_000397340.1.38211 WP_000397340.1.38323 WP_000397340.1.38371 WP_000397340.1.38485 WP_000397340.1.38636 WP_000397340.1.38950 WP_000397340.1.38956 WP_000397340.1.39356 WP_000397340.1.39365 WP_000397340.1.39430 WP_000397340.1.39531 WP_000397340.1.39870 WP_000397340.1.39938 WP_000397340.1.39961 WP_000397340.1.39966 WP_000397340.1.40013 WP_000397340.1.40016 WP_000397340.1.40192 WP_000397340.1.40212 WP_000397340.1.40218 WP_000397340.1.40317 WP_000397340.1.40389 WP_000397340.1.40445 WP_000397340.1.40499 WP_000397340.1.40524 WP_000397340.1.40548 WP_000397340.1.406 WP_000397340.1.40712 WP_000397340.1.40815 WP_000397340.1.40833 WP_000397340.1.40898 WP_000397340.1.40912 WP_000397340.1.40937 WP_000397340.1.40965 WP_000397340.1.41206 WP_000397340.1.4126 WP_000397340.1.41368 WP_000397340.1.41436 WP_000397340.1.41530 WP_000397340.1.41556 WP_000397340.1.41621 WP_000397340.1.41900 WP_000397340.1.42022 WP_000397340.1.42073 WP_000397340.1.42113 WP_000397340.1.42209 WP_000397340.1.42214 WP_000397340.1.42376 WP_000397340.1.4242 WP_000397340.1.42547 WP_000397340.1.42770 WP_000397340.1.4282 WP_000397340.1.42936 WP_000397340.1.42987 WP_000397340.1.4306 WP_000397340.1.43270 WP_000397340.1.43473 WP_000397340.1.43489 WP_000397340.1.43720 WP_000397340.1.43925 WP_000397340.1.44088 WP_000397340.1.44096 WP_000397340.1.44100 WP_000397340.1.44115 WP_000397340.1.44162 WP_000397340.1.44166 WP_000397340.1.44365 WP_000397340.1.44458 WP_000397340.1.44558 WP_000397340.1.44724 WP_000397340.1.44841 WP_000397340.1.44849 WP_000397340.1.44854 WP_000397340.1.44923 WP_000397340.1.44970 WP_000397340.1.45028 WP_000397340.1.4516 WP_000397340.1.45208 WP_000397340.1.45246 WP_000397340.1.45329 WP_000397340.1.45581 WP_000397340.1.45595 WP_000397340.1.4574 WP_000397340.1.45741 WP_000397340.1.4593 WP_000397340.1.45933 WP_000397340.1.46115 WP_000397340.1.46186 WP_000397340.1.46213 WP_000397340.1.46325 WP_000397340.1.46582 WP_000397340.1.4670 WP_000397340.1.46802 WP_000397340.1.46909 WP_000397340.1.46932 WP_000397340.1.47038 WP_000397340.1.47048 WP_000397340.1.47401 WP_000397340.1.47414 WP_000397340.1.47496 WP_000397340.1.47634 WP_000397340.1.47646 WP_000397340.1.47673 WP_000397340.1.4772 WP_000397340.1.47734 WP_000397340.1.47765 WP_000397340.1.47791 WP_000397340.1.48040 WP_000397340.1.48080 WP_000397340.1.48096 WP_000397340.1.48111 WP_000397340.1.48194 WP_000397340.1.48290 WP_000397340.1.48353 WP_000397340.1.486 WP_000397340.1.48860 WP_000397340.1.48953 WP_000397340.1.48974 WP_000397340.1.49009 WP_000397340.1.49531 WP_000397340.1.49537 WP_000397340.1.49645 WP_000397340.1.49661 WP_000397340.1.49733 WP_000397340.1.49768 WP_000397340.1.49883 WP_000397340.1.49900 WP_000397340.1.50006 WP_000397340.1.50008 WP_000397340.1.50078 WP_000397340.1.5017 WP_000397340.1.50262 WP_000397340.1.50452 WP_000397340.1.50579 WP_000397340.1.51042 WP_000397340.1.51172 WP_000397340.1.5146 WP_000397340.1.51495 WP_000397340.1.51539 WP_000397340.1.51552 WP_000397340.1.51607 WP_000397340.1.51784 WP_000397340.1.52002 WP_000397340.1.52020 WP_000397340.1.52076 WP_000397340.1.52127 WP_000397340.1.52186 WP_000397340.1.52214 WP_000397340.1.52243 WP_000397340.1.52305 WP_000397340.1.52399 WP_000397340.1.52492 WP_000397340.1.52544 WP_000397340.1.52558 WP_000397340.1.52774 WP_000397340.1.52780 WP_000397340.1.52844 WP_000397340.1.52895 WP_000397340.1.53012 WP_000397340.1.53020 WP_000397340.1.53110 WP_000397340.1.53377 WP_000397340.1.53428 WP_000397340.1.53545 WP_000397340.1.53645 WP_000397340.1.53769 WP_000397340.1.53994 WP_000397340.1.54002 WP_000397340.1.54344 WP_000397340.1.54507 WP_000397340.1.54602 WP_000397340.1.54605 WP_000397340.1.5461 WP_000397340.1.54617 WP_000397340.1.54620 WP_000397340.1.55003 WP_000397340.1.55123 WP_000397340.1.55203 WP_000397340.1.55374 WP_000397340.1.55466 WP_000397340.1.55529 WP_000397340.1.55551 WP_000397340.1.55571 WP_000397340.1.55574 WP_000397340.1.55629 WP_000397340.1.55676 WP_000397340.1.55825 WP_000397340.1.55868 WP_000397340.1.5614 WP_000397340.1.56164 WP_000397340.1.56846 WP_000397340.1.56934 WP_000397340.1.57181 WP_000397340.1.57386 WP_000397340.1.57401 WP_000397340.1.57403 WP_000397340.1.57410 WP_000397340.1.57414 WP_000397340.1.57432 WP_000397340.1.57846 WP_000397340.1.5786 WP_000397340.1.58080 WP_000397340.1.58316 WP_000397340.1.58401 WP_000397340.1.5842 WP_000397340.1.58420 WP_000397340.1.58429 WP_000397340.1.58440 WP_000397340.1.58867 WP_000397340.1.58940 WP_000397340.1.58951 WP_000397340.1.58958 WP_000397340.1.58976 WP_000397340.1.59024 WP_000397340.1.59306 WP_000397340.1.59407 WP_000397340.1.59513 WP_000397340.1.59553 WP_000397340.1.59590 WP_000397340.1.59615 WP_000397340.1.5965 WP_000397340.1.59998 WP_000397340.1.6002 WP_000397340.1.60031 WP_000397340.1.60343 WP_000397340.1.60498 WP_000397340.1.60505 WP_000397340.1.60550 WP_000397340.1.60576 WP_000397340.1.6061 WP_000397340.1.6066 WP_000397340.1.60717 WP_000397340.1.60895 WP_000397340.1.60901 WP_000397340.1.61096 WP_000397340.1.61505 WP_000397340.1.61663 WP_000397340.1.61779 WP_000397340.1.61822 WP_000397340.1.61858 WP_000397340.1.61949 WP_000397340.1.62099 WP_000397340.1.62612 WP_000397340.1.62735 WP_000397340.1.62750 WP_000397340.1.62787 WP_000397340.1.62812 WP_000397340.1.62840 WP_000397340.1.62919 WP_000397340.1.62989 WP_000397340.1.63167 WP_000397340.1.6337 WP_000397340.1.63453 WP_000397340.1.64040 WP_000397340.1.64080 WP_000397340.1.64285 WP_000397340.1.64448 WP_000397340.1.647 WP_000397340.1.64784 WP_000397340.1.64789 WP_000397340.1.64912 WP_000397340.1.65271 WP_000397340.1.65353 WP_000397340.1.65364 WP_000397340.1.65961 WP_000397340.1.66050 WP_000397340.1.66104 WP_000397340.1.66105 WP_000397340.1.66127 WP_000397340.1.6635 WP_000397340.1.66387 WP_000397340.1.66389 WP_000397340.1.66395 WP_000397340.1.66501 WP_000397340.1.6654 WP_000397340.1.66559 WP_000397340.1.6665 WP_000397340.1.66700 WP_000397340.1.66719 WP_000397340.1.66933 WP_000397340.1.67022 WP_000397340.1.67137 WP_000397340.1.67415 WP_000397340.1.67468 WP_000397340.1.67538 WP_000397340.1.67553 WP_000397340.1.67786 WP_000397340.1.67787 WP_000397340.1.67853 WP_000397340.1.67861 WP_000397340.1.67975 WP_000397340.1.68008 WP_000397340.1.6803 WP_000397340.1.6814 WP_000397340.1.68215 WP_000397340.1.68341 WP_000397340.1.68711 WP_000397340.1.68797 WP_000397340.1.6916 WP_000397340.1.69258 WP_000397340.1.69261 WP_000397340.1.69303 WP_000397340.1.69305 WP_000397340.1.69473 WP_000397340.1.69646 WP_000397340.1.69803 WP_000397340.1.70407 WP_000397340.1.70578 WP_000397340.1.70619 WP_000397340.1.70767 WP_000397340.1.70794 WP_000397340.1.70880 WP_000397340.1.71159 WP_000397340.1.71199 WP_000397340.1.71229 WP_000397340.1.71312 WP_000397340.1.71323 WP_000397340.1.71397 WP_000397340.1.71409 WP_000397340.1.71480 WP_000397340.1.71522 WP_000397340.1.71690 WP_000397340.1.71783 WP_000397340.1.71837 WP_000397340.1.71938 WP_000397340.1.71944 WP_000397340.1.71975 WP_000397340.1.7210 WP_000397340.1.72157 WP_000397340.1.72184 WP_000397340.1.72337 WP_000397340.1.72397 WP_000397340.1.72431 WP_000397340.1.72485 WP_000397340.1.72537 WP_000397340.1.72606 WP_000397340.1.72616 WP_000397340.1.72747 WP_000397340.1.72860 WP_000397340.1.72869 WP_000397340.1.72910 WP_000397340.1.73085 WP_000397340.1.73129 WP_000397340.1.73217 WP_000397340.1.73295 WP_000397340.1.73385 WP_000397340.1.73524 WP_000397340.1.73565 WP_000397340.1.73604 WP_000397340.1.73717 WP_000397340.1.73835 WP_000397340.1.73844 WP_000397340.1.73859 WP_000397340.1.73942 WP_000397340.1.74309 WP_000397340.1.74365 WP_000397340.1.74445 WP_000397340.1.74520 WP_000397340.1.74528 WP_000397340.1.7461 WP_000397340.1.74625 WP_000397340.1.74688 WP_000397340.1.74691 WP_000397340.1.74713 WP_000397340.1.7475 WP_000397340.1.74962 WP_000397340.1.74998 WP_000397340.1.75139 WP_000397340.1.75243 WP_000397340.1.75272 WP_000397340.1.75491 WP_000397340.1.75537 WP_000397340.1.75612 WP_000397340.1.75644 WP_000397340.1.75679 WP_000397340.1.75699 WP_000397340.1.75983 WP_000397340.1.75995 WP_000397340.1.76196 WP_000397340.1.76312 WP_000397340.1.76446 WP_000397340.1.76462 WP_000397340.1.76701 WP_000397340.1.76815 WP_000397340.1.77214 WP_000397340.1.77470 WP_000397340.1.77471 WP_000397340.1.77595 WP_000397340.1.77636 WP_000397340.1.77648 WP_000397340.1.77768 WP_000397340.1.77876 WP_000397340.1.78000 WP_000397340.1.78007 WP_000397340.1.78089 WP_000397340.1.78196 WP_000397340.1.78321 WP_000397340.1.7847 WP_000397340.1.78612 WP_000397340.1.78750 WP_000397340.1.78953 WP_000397340.1.7896 WP_000397340.1.79004 WP_000397340.1.79086 WP_000397340.1.79246 WP_000397340.1.79312 WP_000397340.1.79505 WP_000397340.1.79558 WP_000397340.1.79685 WP_000397340.1.79840 WP_000397340.1.7987 WP_000397340.1.79871 WP_000397340.1.79984 WP_000397340.1.80136 WP_000397340.1.80255 WP_000397340.1.80428 WP_000397340.1.80440 WP_000397340.1.80517 WP_000397340.1.8057 WP_000397340.1.80768 WP_000397340.1.80804 WP_000397340.1.80805 WP_000397340.1.80884 WP_000397340.1.8090 WP_000397340.1.81034 WP_000397340.1.81054 WP_000397340.1.81313 WP_000397340.1.81577 WP_000397340.1.81589 WP_000397340.1.81715 WP_000397340.1.81723 WP_000397340.1.81832 WP_000397340.1.81939 WP_000397340.1.82275 WP_000397340.1.82316 WP_000397340.1.8235 WP_000397340.1.82439 WP_000397340.1.82647 WP_000397340.1.82700 WP_000397340.1.82715 WP_000397340.1.83020 WP_000397340.1.8308 WP_000397340.1.83097 WP_000397340.1.831 WP_000397340.1.83224 WP_000397340.1.83537 WP_000397340.1.83735 WP_000397340.1.83941 WP_000397340.1.8411 WP_000397340.1.84331 WP_000397340.1.84405 WP_000397340.1.84410 WP_000397340.1.8444 WP_000397340.1.84534 WP_000397340.1.84584 WP_000397340.1.84697 WP_000397340.1.84738 WP_000397340.1.84740 WP_000397340.1.84977 WP_000397340.1.84989 WP_000397340.1.85002 WP_000397340.1.85216 WP_000397340.1.85247 WP_000397340.1.85255 WP_000397340.1.85260 WP_000397340.1.85310 WP_000397340.1.85621 WP_000397340.1.85752 WP_000397340.1.85857 WP_000397340.1.8592 WP_000397340.1.86001 WP_000397340.1.86161 WP_000397340.1.8621 WP_000397340.1.86412 WP_000397340.1.86452 WP_000397340.1.86461 WP_000397340.1.86475 WP_000397340.1.86609 WP_000397340.1.86691 WP_000397340.1.86787 WP_000397340.1.86848 WP_000397340.1.86959 WP_000397340.1.86997 WP_000397340.1.87199 WP_000397340.1.87389 WP_000397340.1.87563 WP_000397340.1.87610 WP_000397340.1.87721 WP_000397340.1.87857 WP_000397340.1.87914 WP_000397340.1.87919 WP_000397340.1.88017 WP_000397340.1.88110 WP_000397340.1.88301 WP_000397340.1.88304 WP_000397340.1.88434 WP_000397340.1.88607 WP_000397340.1.88729 WP_000397340.1.8879 WP_000397340.1.88961 WP_000397340.1.89090 WP_000397340.1.89099 WP_000397340.1.89416 WP_000397340.1.89458 WP_000397340.1.89468 WP_000397340.1.89471 WP_000397340.1.89674 WP_000397340.1.89679 WP_000397340.1.89923 WP_000397340.1.90017 WP_000397340.1.90078 WP_000397340.1.90168 WP_000397340.1.90256 WP_000397340.1.90358 WP_000397340.1.9036 WP_000397340.1.90511 WP_000397340.1.90520 WP_000397340.1.90536 WP_000397340.1.90828 WP_000397340.1.90951 WP_000397340.1.91170 WP_000397340.1.91277 WP_000397340.1.91340 WP_000397340.1.91341 WP_000397340.1.91445 WP_000397340.1.91462 WP_000397340.1.91551 WP_000397340.1.9169 WP_000397340.1.91739 WP_000397340.1.91994 WP_000397340.1.9215 WP_000397340.1.92161 WP_000397340.1.92361 WP_000397340.1.92496 WP_000397340.1.92614 WP_000397340.1.92615 WP_000397340.1.92742 WP_000397340.1.92792 WP_000397340.1.92845 WP_000397340.1.92865 WP_000397340.1.92943 WP_000397340.1.93019 WP_000397340.1.93048 WP_000397340.1.93054 WP_000397340.1.93175 WP_000397340.1.93276 WP_000397340.1.93312 WP_000397340.1.93652 WP_000397340.1.93673 WP_000397340.1.93755 WP_000397340.1.93911 WP_000397340.1.94025 WP_000397340.1.94176 WP_000397340.1.94271 WP_000397340.1.94388 WP_000397340.1.94445 WP_000397340.1.94542 WP_000397340.1.9457 WP_000397340.1.94764 WP_000397340.1.9489 WP_000397340.1.94898 WP_000397340.1.94938 WP_000397340.1.94949 WP_000397340.1.94993 WP_000397340.1.95037 WP_000397340.1.95332 WP_000397340.1.95595 WP_000397340.1.95827 WP_000397340.1.95849 WP_000397340.1.95919 WP_000397340.1.96215 WP_000397340.1.96299 WP_000397340.1.96303 WP_000397340.1.96339 WP_000397340.1.96394 WP_000397340.1.96417 WP_000397340.1.97011 WP_000397340.1.97123 WP_000397340.1.97231 WP_000397340.1.97667 WP_000397340.1.97982 WP_000397340.1.98294 WP_000397340.1.98355 WP_000397340.1.98424 WP_000397340.1.98477 WP_000397340.1.98776 WP_000397340.1.99392 WP_000397340.1.99453 WP_000397340.1.99534 WP_000397340.1.99602 WP_000397340.1.99603 gi|386704009|ref|YP_006167856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]