SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ihcA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ihcA
Domain Number 1 Region: 16-178
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 6.74e-75
Family MogA-like 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1ihcA   PDB: 1ihc   SUPERFAMILY: 1ihcA
Sequence length 188
Comment (A:)
Sequence
mategmiltnhdhqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivp
deieeiketlidwcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgsl
nvtplgmlsrpvcgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevh
deledlps
Download sequence
Identical sequences cath|current|1ihcA00/13-181 1ihcA 1ihc_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]