SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jljA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jljA
Domain Number 1 Region: 16-178
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 6.89e-75
Family MogA-like 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1jljA   PDB: 1jlj   SUPERFAMILY: 1jljA
Sequence length 189
Comment (A:)
Sequence
mategmiltnhdhqirvgvltvsdscfrnlaedrsginlkdlvqdpsllggtisaykivp
deieeiketlidwcdekelnlilttggtgfaprdvtpeatkeviereapgmalamlmgsl
nvtplgmlsrpvcgirgktliinlpgskkgsqecfqfilpalphaidllrdaivkvkevh
drshhhhhh
Download sequence
Identical sequences 1jljA 1jlj_A 1jlj_B 1jlj_C cath|current|1jljA00/13-181 cath|current|1jljB00/13-181 cath|current|1jljC00/13-181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]