SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mkzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mkzA
Domain Number 1 Region: 12-155
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 6.23e-57
Family MogA-like 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1mkzA   PDB: 1mkz   SUPERFAMILY: 1mkzA
Sequence length 172
Comment (A:)
Sequence
msqvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaq
vsawiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlq
sravagvanktlilampgstkacrtaweniiapqldartrpcnfhphlkkgs
Download sequence
Identical sequences 1mkzA 1mkz_A 1mkz_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]