SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1o8nA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1o8nA
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 5.49e-66
Family MogA-like 0.0000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1o8nA   PDB: 1o8n   SUPERFAMILY: 1o8nA
Sequence length 167
Comment (A:)
Sequence
vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
dilqkwsdvdemdliltlggagftprdvtpeatkkvieretpgllfvmmqeslkitpfam
lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqikgdkr
Download sequence
Identical sequences cath|current|1o8nA00/3-165 cath|current|1o8nB00/3-165 cath|current|1o8nC00/3-165 1o8n_A 1o8n_B 1o8n_C 1o8nA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]