SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1o8oA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1o8oA
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 8.79e-64
Family MogA-like 0.0000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1o8oA   PDB: 1o8o   SUPERFAMILY: 1o8oA
Sequence length 167
Comment (A:)
Sequence
vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
dilqkwsdvdemdliltlggdgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqikgdkr
Download sequence
Identical sequences 1o8o_A 1o8o_B 1o8o_C 1o8oA cath|current|1o8oA00/3-164 cath|current|1o8oB00/3-166 cath|current|1o8oC00/3-164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]