SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1o8qA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1o8qA
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 2.64e-68
Family MogA-like 0.00000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1o8qA   PDB: 1o8q   SUPERFAMILY: 1o8qA
Sequence length 167
Comment (A:)
Sequence
vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqealkitpfam
lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqikgdkr
Download sequence
Identical sequences 1o8qA cath|current|1o8qA00/5-164 cath|current|1o8qB00/5-164 cath|current|1o8qC00/5-164 cath|current|1o8qD00/5-164 cath|current|1o8qE00/5-164 cath|current|1o8qF00/5-164 cath|current|1o8qG00/5-164 cath|current|1o8qH00/5-164 1o8q_A 1o8q_B 1o8q_C 1o8q_D 1o8q_E 1o8q_F 1o8q_G 1o8q_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]