SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1r2kA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1r2kA
Domain Number 1 Region: 11-154
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 6.37e-58
Family MogA-like 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1r2kA   PDB: 1r2k   SUPERFAMILY: 1r2kA
Sequence length 169
Comment (A:)
Sequence
sqvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqv
sawiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqs
ravagvanktlifampgstkacrtaweniiapqldartrpcnfhphlkk
Download sequence
Identical sequences 1r2k_A 1r2k_B 1r2kA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]