SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1t3eA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1t3eA
Domain Number 1 Region: 186-330
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.68e-55
Family MoeA central domain-like 0.000000318
Further Details:      
 
Domain Number 2 Region: 4-181
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 8.79e-53
Family MoeA N-terminal region -like 0.0000000104
Further Details:      
 
Domain Number 3 Region: 339-419
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 3.59e-26
Family MoeA C-terminal domain-like 0.00000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1t3eA   PDB: 1t3e
Sequence length 421
Comment (A:)
Sequence
hrmspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdg
yavraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedtelire
sddgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevev
nkfpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddll
nalnegisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldid
gvrkiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhr
ciltwhhqeplpwaqstgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigr
l
Download sequence
Identical sequences 1t3e_A 1t3e_B 1t3eA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]