SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1uuxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1uuxA
Domain Number 1 Region: 7-163
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 8.79e-67
Family MogA-like 0.0000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1uuxA   PDB: 1uux   SUPERFAMILY: 1uuxA
Sequence length 163
Comment (A:)
Sequence
vpgpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverik
dilqkwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqeslkitpfam
lsrsaagirgstliinmpgnpnavaecmeallpalkhalkqia
Download sequence
Identical sequences 1uux_A 1uuxA cath|current|1uuxA00/3-163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]