SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1uz5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1uz5A
Domain Number 1 Region: 7-180
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 4.03e-53
Family MoeA N-terminal region -like 0.000000017
Further Details:      
 
Domain Number 2 Region: 181-325
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 2.71e-42
Family MoeA central domain-like 0.000000301
Further Details:      
 
Domain Number 3 Region: 333-401
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 1.54e-18
Family MoeA C-terminal domain-like 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1uz5A   PDB: 1uz5
Sequence length 402
Comment (A:)
Sequence
MAFLKVVPLEKALEVVQSFKISPGIEEVPIEKGLGRIAAEDIYSPIDVPPFDRATVDGYA
VRAEDTFMASEASPVRLKVIGSVHAGEEPKFKLGKGEAAYISTGAMLPGNADAVIQFEDV
ERVNGEILIYKPAYPGLGVMKKGIDIEKGRLLVKKGERLGFKQTALLSAVGINKVKVFRK
PKVAVISTGNEIVPPGNELKPGQIYDINGRALCDAINELGGEGIFMGVARDDKESLKALI
EKAVNVGDVVVISGGASGGTKDLTASVIEELGEVKVHGIAIQPGKPTIIGVIKGKPVFGL
PGYPTSCLTNFTLLVVPLLLRALGREGKIGKKVARLKHKVFSVKGRRQFLPVKLEGDLAV
PILKGSGAVTSFIDADGFVEIPETVESLDEGEEVEVTLFKGW
Download sequence
Identical sequences O58335
1uz5A gi|14590478|ref|NP_142546.1| 1uz5_A 70601.PH0582 WP_010884682.1.38245 pho001000582.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]