SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wu2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wu2A
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 4.47e-57
Family MoeA N-terminal region -like 0.000000019
Further Details:      
 
Domain Number 2 Region: 182-322
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.34e-34
Family MoeA central domain-like 0.000000262
Further Details:      
 
Domain Number 3 Region: 327-396
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 1.68e-17
Family MoeA C-terminal domain-like 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1wu2A   PDB: 1wu2
Sequence length 396
Comment (A:)
Sequence
MMEFKKLVPYREALKLLLDDINEIEDTEKVPLREAVGRVLAEDIVTEFDIPPFDRAAVDG
YAIRAEDTFQAREYNPIELTVIEEVPAGNVAKEEVTTGKAIKVLTGTRIPKGANAVIMQE
MVKREGDKIYVLRPVAPGQNIAFTGEDVKKGEVVLRKGTILRPQDVAMLKALGIKKVPVK
VKPKVGIIITGSELIEEPSEEGFKEGKIVETNSIMLQGLVEKFFGEPILYGVLPDDESII
KETLEKAKNECDIVLITGGSAFGDKDYAHKFVNLLFHGTTIKPGRPFGYGEKVFIMSGYP
VSVFAQFNLFVKHALAKMVGAQNYEVKVKAILQDDIPSQLGRYEFIKIYYENGIARVIKK
KGSGILSSLLASNAYLEIPEDSEGYRRGEEVWITLY
Download sequence
Identical sequences O59354
pho001001647.1 1wu2A 1wu2_A 1wu2_B gi|14591417|ref|NP_143497.1| 70601.PH1647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]