SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xi8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xi8A
Domain Number 1 Region: 14-186
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 7.1e-58
Family MoeA N-terminal region -like 0.0000000195
Further Details:      
 
Domain Number 2 Region: 189-328
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.17e-35
Family MoeA central domain-like 0.00000029
Further Details:      
 
Domain Number 3 Region: 334-403
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 1.83e-19
Family MoeA C-terminal domain-like 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1xi8A   PDB: 1xi8
Sequence length 403
Comment (A:)
Sequence
ahhhhhhgsefkrltpyeealsivlndlkeieeveyvplkdalgrvlaedivasydlppf
draavdgyavraedtfeareyspvelevieevpigenpnkeviagkaikvltggkiprga
navimqemvkregskiyvlrpvapgqnisfagedvkkgdialkkgtilrpqdlallkalg
irkvpvkvkpkvgiiitgselvqepsleefekgkivdtnsimlsalveryfgepilygvv
pdnedlirsalekakrecdlvlitggsafgdmdyahkfvnllfhgttirpgrpigygerv
fvmsgypvavftqfhlfvkhalaklvgakdyevkvravleddvpsqlgryefvrvmyrdg
kakvikkkgsgiisslvqsnaylvvpedvegyrrgeevwvtly
Download sequence
Identical sequences 1xi8A 1xi8_A 1xi8_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]