SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1y5eA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1y5eA
Domain Number 1 Region: 17-162
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 3e-59
Family MogA-like 0.00000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1y5eA   PDB: 1y5e
Sequence length 169
Comment (A:)
Sequence
MSVTEHKKQAPKEVRCKIVTISDTRTEETDKSGQLLHELLKEAGHKVTSYEIVKDDKESI
QQAVLAGYHKEDVDVVLTNGGTGITKRDVTIEAVSALLDKEIVGFGELFRMISYLEDIGS
SAMLSRAIGGTIGRKVVFSMPGSSGAVRLAMNKLILPELGHITFELHRQ
Download sequence
Identical sequences A0A023PDH1 A0A0E9GQZ4 A0A0F6FQQ7 A0A0G3E7T0 A0A0G4CTB7 A0A0G8ER49 A0A0W7Y8C7 A0A135WT27 A0A193CZ57 A0A1M6MXA9 A0A1Q9KS58 A0A1W2GEE2 A0A229M7J4 A0A242ZIR2 A0A243BZ81 A0A243DPA4 A0A243EWA2 A0A243IIK6 A0A243J880 A0A243L5M8 A0A243NQ76 A0A2B4NZY8 A0A2C9ZCK3 C2N801 C2P591 C2T7F8 C2UKD2 C2WU69 C2XI58 C3H7P5 G9Q0B5 J7Z476 J8FG48 J8G7D4 J8J3F1 Q816R0 R8EBI8 R8GRH7 R8L6E7 R8PF88
APC25161 226900.BC4758 1y5e_A 1y5e_B 1y5e_C gi|30022831|ref|NP_834462.1| gi|449091727|ref|YP_007424168.1| 1y5eA NP_834462.1.86172 WP_000117124.1.100912 WP_000117124.1.10688 WP_000117124.1.10745 WP_000117124.1.10845 WP_000117124.1.1112 WP_000117124.1.11584 WP_000117124.1.12553 WP_000117124.1.13498 WP_000117124.1.14174 WP_000117124.1.14176 WP_000117124.1.18749 WP_000117124.1.19438 WP_000117124.1.19516 WP_000117124.1.20208 WP_000117124.1.20651 WP_000117124.1.21055 WP_000117124.1.2206 WP_000117124.1.2251 WP_000117124.1.23181 WP_000117124.1.23307 WP_000117124.1.24680 WP_000117124.1.24795 WP_000117124.1.25290 WP_000117124.1.25599 WP_000117124.1.26483 WP_000117124.1.26513 WP_000117124.1.26637 WP_000117124.1.26826 WP_000117124.1.26872 WP_000117124.1.26965 WP_000117124.1.27106 WP_000117124.1.27931 WP_000117124.1.28237 WP_000117124.1.29836 WP_000117124.1.29993 WP_000117124.1.3180 WP_000117124.1.32927 WP_000117124.1.33201 WP_000117124.1.33717 WP_000117124.1.34175 WP_000117124.1.34587 WP_000117124.1.37239 WP_000117124.1.38345 WP_000117124.1.38427 WP_000117124.1.38591 WP_000117124.1.39411 WP_000117124.1.40034 WP_000117124.1.40430 WP_000117124.1.41464 WP_000117124.1.41518 WP_000117124.1.4185 WP_000117124.1.41879 WP_000117124.1.42167 WP_000117124.1.42218 WP_000117124.1.42485 WP_000117124.1.43442 WP_000117124.1.43767 WP_000117124.1.43914 WP_000117124.1.44348 WP_000117124.1.44428 WP_000117124.1.44449 WP_000117124.1.44497 WP_000117124.1.44956 WP_000117124.1.45720 WP_000117124.1.46326 WP_000117124.1.49455 WP_000117124.1.49702 WP_000117124.1.5025 WP_000117124.1.50694 WP_000117124.1.51047 WP_000117124.1.54240 WP_000117124.1.54736 WP_000117124.1.54777 WP_000117124.1.55077 WP_000117124.1.55116 WP_000117124.1.5543 WP_000117124.1.55788 WP_000117124.1.56320 WP_000117124.1.57732 WP_000117124.1.58586 WP_000117124.1.58632 WP_000117124.1.58822 WP_000117124.1.60153 WP_000117124.1.6304 WP_000117124.1.63743 WP_000117124.1.63789 WP_000117124.1.64282 WP_000117124.1.64568 WP_000117124.1.64764 WP_000117124.1.65803 WP_000117124.1.66999 WP_000117124.1.67001 WP_000117124.1.674 WP_000117124.1.6743 WP_000117124.1.67912 WP_000117124.1.68007 WP_000117124.1.6816 WP_000117124.1.68346 WP_000117124.1.6846 WP_000117124.1.68562 WP_000117124.1.69501 WP_000117124.1.70181 WP_000117124.1.71114 WP_000117124.1.71242 WP_000117124.1.73790 WP_000117124.1.74302 WP_000117124.1.74372 WP_000117124.1.74832 WP_000117124.1.74857 WP_000117124.1.74863 WP_000117124.1.74976 WP_000117124.1.7544 WP_000117124.1.75866 WP_000117124.1.76155 WP_000117124.1.76883 WP_000117124.1.76902 WP_000117124.1.77386 WP_000117124.1.80649 WP_000117124.1.81000 WP_000117124.1.83694 WP_000117124.1.83977 WP_000117124.1.85592 WP_000117124.1.85928 WP_000117124.1.86374 WP_000117124.1.86637 WP_000117124.1.869 WP_000117124.1.87013 WP_000117124.1.87725 WP_000117124.1.87777 WP_000117124.1.87873 WP_000117124.1.87947 WP_000117124.1.88154 WP_000117124.1.88200 WP_000117124.1.88269 WP_000117124.1.89009 WP_000117124.1.89718 WP_000117124.1.90254 WP_000117124.1.90352 WP_000117124.1.90665 WP_000117124.1.93683 WP_000117124.1.9623 WP_000117124.1.96437 WP_000117124.1.97082 WP_000117124.1.97262 WP_000117124.1.97327 WP_000117124.1.97561 WP_000117124.1.97842 WP_000117124.1.98053 WP_000117124.1.9860 WP_000117124.1.98604 WP_000117124.1.99636 gi|296505228|ref|YP_003666928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]