SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2c42A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2c42A
Domain Number 1 Region: 786-1227
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.13e-133
Family PFOR PP module 0.0000000000000615
Further Details:      
 
Domain Number 2 Region: 415-667
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.24e-88
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000000168
Further Details:      
 
Domain Number 3 Region: 2-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.55e-78
Family PFOR Pyr module 0.000000000312
Further Details:      
 
Domain Number 4 Region: 258-409
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6e-50
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.000000103
Further Details:      
 
Domain Number 5 Region: 664-831
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.2e-21
Family Ferredoxin domains from multidomain proteins 0.00000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2c42A   PDB: 2c42
Sequence length 1231
Comment (A:)
Sequence
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
mmarpdsgeacdqnragtseqqgdlskrtkk
Download sequence
Identical sequences 2c42A 1b0p_A 1b0p_B 1kek_A 1kek_B 2c3m_A 2c3m_B 2c3o_A 2c3o_B 2c3p_A 2c3p_B 2c3u_A 2c3u_B 2c3y_A 2c3y_B 2c42_A 2c42_B 2pda_A 2pda_B 2uza_A 2uza_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]