SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2f7wA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2f7wA
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 4.61e-84
Family MogA-like 0.0000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2f7wA   PDB: 2f7w
Sequence length 177
Comment (A:)
Sequence
MSKAKIGIVTVSDRASAGIYEDISGKAIIDTLNDYLTSEWEPIYQVIPDEQDVIETTLIK
MADEQDCCLIVTTGGTGPAKRDVTPEATEAVCDRMMPGFGELMRAESLKFVPTAILSRQT
AGLRGDSLIVNLPGKPKSIRECLDAVFPAIPYCIDLMEGPYLECNEAVIKPFRPKAK
Download sequence
Identical sequences Q8EKM7
211586.SO_0065 2f7wA APC84718 NP_715707.1.27637 2f7w_A 2f7w_B 2f7w_C 2f7y_A 2f7y_B 2f7y_C gi|24371665|ref|NP_715707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]