SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ftsA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ftsA
Domain Number 1 Region: 184-328
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 1.61e-55
Family MoeA central domain-like 0.000000318
Further Details:      
 
Domain Number 2 Region: 2-179
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 8.79e-53
Family MoeA N-terminal region -like 0.0000000104
Further Details:      
 
Domain Number 3 Region: 337-417
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 3.51e-26
Family MoeA C-terminal domain-like 0.00000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ftsA   PDB: 2fts
Sequence length 419
Comment (A:)
Sequence
mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
fpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllna
lnegisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgv
rkiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrci
ltwhhqeplpwaqstgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl
Download sequence
Identical sequences XP_017170569.1.92730 2fts_A 2fu3_A 2fu3_B 4pd0_A 4pd1_A 4tk1_A 4tk1_B 4tk2_A 4tk2_B 4tk3_A 4tk3_B 4tk4_A 4tk4_B 4u90_A 4u91_A 5erq_A 5err_A 5ers_A 5ert_A 5eru_A 5erv_A 2ftsA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]