SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2g2cA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2g2cA
Domain Number 1 Region: 5-162
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 6.23e-31
Family MogA-like 0.00000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2g2cA   PDB: 2g2c
Sequence length 167
Comment (A:)
Sequence
snamhiksaiivvsdristgtrenkalpllqrlmsdelqdysyelisevvvpegydtvve
aiatalkqgarfiitaggtgiraknqtpeatasfihtrcegleqqilihgsththlagls
rgivgvtgrddhaalivnapsssggitdtwavispvipnifegldas
Download sequence
Identical sequences 2g2c_A 2g2cA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]