SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2nqkA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2nqkA
Domain Number 1 Region: 7-177
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 2.78e-58
Family MoeA N-terminal region -like 0.0000000182
Further Details:      
 
Domain Number 2 Region: 178-317
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 3.66e-50
Family MoeA central domain-like 0.000000304
Further Details:      
 
Domain Number 3 Region: 328-407
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 5.27e-25
Family MoeA C-terminal domain-like 0.00000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2nqkA   PDB: 2nqk
Sequence length 411
Comment (A:)
Sequence
mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamng
yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
Download sequence
Identical sequences 2nqkA 2nqk_A 2nqk_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]