SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085726 from Drosophila melanogaster 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085726
Domain Number 1 Region: 457-752
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-77
Family Protein kinases, catalytic subunit 0.0000000437
Further Details:      
 
Domain Number 2 Region: 1241-1382
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 6.67e-54
Family FAT domain of focal adhesion kinase 0.0000407
Further Details:      
 
Domain Number 3 Region: 141-260
Classification Level Classification E-value
Superfamily Second domain of FERM 1.13e-33
Family Second domain of FERM 0.00017
Further Details:      
 
Domain Number 4 Region: 263-392
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-25
Family Third domain of FERM 0.0011
Further Details:      
 
Domain Number 5 Region: 20-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000119
Family First domain of FERM 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085726   Gene: FBgn0020440   Transcript: FBtr0086542
Sequence length 1500
Comment pep:known chromosome:BDGP5:2R:15318164:15324760:-1 gene:FBgn0020440 transcript:FBtr0086542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTAGATSQPPPTKNEINSEEYLIHVHMPNKSFKAVRFNVKETVFHVIRRTVEDLGTDGR
TPSIQRYACRMLNMITKEVIWLARSTSMQKVLSHILTPGCSNVDCPNNQSELDEVLLEHG
RRITDNRVWRVELRVRYVPNNIQELFEEDKATCFYYFNQVKEDFIQANVTAIDTEVAVQL
CCLGIRHYFKNITVKAPDKKQHIDYIEKEIGFKSFLPQSVIATSKPKNLKKLIQVGYKKV
YNYNDIEYLTRFFDLLKNIYLTNFEQFSVTLSSAWNISGILHVGPHIGISYQTHPQASLK
NVAQFKDVVSIKTCTLPKEKLSKSGENTTEPELQNFNCNCQKIKTQIKISASNNVEDLVI
TCNGINTAESIADLIDGYCRLLSKDLEFTIWHRETNASNEDSAKALPNDATLGSNKSTSS
QGKPMLTDDYAEIGLLEGEGDYSTPTVRNYELDRALITPSAKIGVGQFGDVYVGTYTLPK
LGKGKNLAGNGKNSNSDQRNADSRPDVIQVAIKTCKANDDPEKTENFLAEAYIMQKFDHP
HIIRLIGICSVMPIWIVMELAKLGELRAYLKTNSERLSHGTLLKYCYQLSTALSYLESKK
FVHRDIAARNVLVSSPTCVKLADFGLSRWVSDQSYYHSTPTVALPIKWMSPESINFRRFT
TASDVWMFGVCIWEILMLGVKPFQGVKNSDVILKLENGERLPLPPNCPPRLYSLMSQCWA
YEPLKRPNFKRIKETLHEILIEDSINSSETLKREQRKVASMSWIGSDDIDIPPSKPSRVM
HDPDITGLMPETTGLPQTYIIAQNPAVLAKLMMENQKRGINPAAYTTPASVFNTLAVGLD
DSNPNVSLKTTKLPAADLLKLDPIAESERLRSQFSANSSASQLANPLTASVNPHESLNSH
QAGMFTGSLPSKSSFVVCPPQTEEHMQAENISNPSVSKVSGYSLYGSLERHQPPPAKAMH
SKGGSLERHQSLMSAQNLVFYNTKPPPNCTNTAERSRSMERNTYFHAYRQQMKTSIECEA
LPEEIYDFGGIGLKTCVSARQQPKFSPMVNVRPAELGQVQNTDCMGLQQNIPMDSFGVIS
PHNLDESLRHQREMERQWMTSGPQSITVNPNISISEGAACLATLQAEAMGNQGIHNVLGE
KLRQQQKDSNSDSEWLIQEELLRSCSIPQGSLNDHQAQMFKLDFMSAGPSSLPDCSNSSS
RPMTPNANLSSLKSNHSSADHLSSLTSAEEQMGSNARNLGSAVPSRPPNRADDEVYCATT
LVVKSIMALSQGVEKANTEGYLELVKNVGVKLRNLLTSVDKISIIFPAQALKEVQMAHQV
LSKDMHELVSAMRLAQQYSDTTLDCEYRKSMLSAAHVLAMDAKNLFDVVDSIRQRYQHLF
PPSATKETSCSSSFESTSGSIVAEPVNDLGGYIKTSTSGDLLQNTGIYDNDLHHSFNSQL
QLQNPKASIDLSGGGSLQRGMSLGLDTTRSTNEPLRIVEETLGSPGEHMYCNTSALHGHA
Download sequence
Identical sequences B7YZL9
7227.FBpp0113097 FBpp0085726 FBpp0113097 FBpp0113097 NP_001137718.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]