SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|29374718|ref|NP_813870.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29374718|ref|NP_813870.1|
Domain Number 1 Region: 685-963
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.77e-68
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000997
Further Details:      
 
Domain Number 2 Region: 105-418
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.48e-67
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 974-1192
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 4.71e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000479
Further Details:      
 
Domain Number 4 Region: 418-632
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.57e-41
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29374718|ref|NP_813870.1|
Sequence length 1313
Comment 5'-nucleotidase [Enterococcus faecalis V583]
Sequence
MKKLSFKKVKWGMHFLMAVALIAPSVTSTAYAVETTSQQSSEAVTSTTDSSRKQEPVITQ
ETTDIKQEAPNQATSDSVKQSQETTAPTETTNLETSIAEKEETSTPQKITILGTSDVHGQ
LWNWSYEDDKELPVGLSQVSTVVNQVRAQNPAGTVLIDNGDNIQGTILTDDLYNKAPLVN
EKTHPMITAMNVMKYDAMVLGNHEFNFGLPLIKKIQQEATFPILSANTYNKEDGLRFVEG
TTTKELDFNQDGQPDLKVGIIGLTIPHIPLWDGPRVTSLNFLPLKEEAEKAVTELKANDQ
ADIIVASIHAGQQNSDPAASADQVIENVAGIDAYILGHDHLSFTKQGAAPNGKTVPVGGP
KDTGTEVVKIDLSVAKNADKWEVQEGTATIVPTTNVPADEAVKAATKEYHEKTRAFIQEE
IGTATADFLPKQEIKGIPEAQLQPTAMISLINNVQKEVTGAQLSAAALFKYDSKLPAGKI
SYATIFDIYKYPNTLVSVPINGENLLKYLEKQGAYYNQTQPDDLTISFNPNIRVYNYDMI
SGVDYKIDISKPVGERIVDAKIDGQPLDPAKEYTIAMNNYRYGGLASQGIQVGEPIKNSD
PETLRGMIVDYIKKKGTLDPEQEIERNWSIIGTNFDEKWRAKAIELVNDGTLQIPTSPDG
RTPNAAAITKQDVRNAGFDLDNAYTIMHTNDVHGRLEAGKGELGMARLKTFKDQENPTLM
VDAGDVFQGLPISNFSKGADMAKAMNEVGYDAMAVGNHEFDFGLEIALGYKDQLNFPILS
SNTYYKDGSGRVFDPYTIVEKSGKKFAIVGVTTPETATKTHPKNVEKVTFKDPIPEVEAV
IKEIKEKYADIQAFVVTGHLGVDETTPHIWRGDTLAETLSQTYPELDITVIDGHSHTAVE
SGKRYGKVIYAQTGNYLNNVGIVTAPESEPTKKTTKLISAAELLELPENPAVKAIVDEAR
TNFNAENEKVIVDYIPFTLDGQRENVRTRETNLGNLIGDAIMSYGQDAFSQPADFAVTNG
GGIRADIKQGPIKVGDVIAVLPFGNSIAQIQVTGAQVKEMFEMSVRSIPQKDENGTILLD
DAGQPKLGANGGFLHVSSSIRIHYDSTKPGTRLASDEGNETGQTIVGSRVLGIEIKNRQT
QKFEPLDEKKQYRMATNDFLAAGGDGYDMLGGEREEGISLDSVLIEYLKSATSLRLYRAA
TTIDLAQYKEPFPGERIVSISEEAYKELIGGGETPKPDPKPDPKPTPETPVATNKQNQAG
ARQSNPSVTEKKKYGGFLPKTGTETETLALYGLLFVGLSSSGWYIYKRRNKAS
Download sequence
Identical sequences Q839U0
NP_813870.1.90627 WP_010714156.1.101818 WP_010714156.1.10696 WP_010714156.1.12926 WP_010714156.1.13739 WP_010714156.1.14157 WP_010714156.1.14180 WP_010714156.1.16241 WP_010714156.1.16763 WP_010714156.1.17287 WP_010714156.1.17799 WP_010714156.1.18048 WP_010714156.1.18260 WP_010714156.1.20659 WP_010714156.1.23054 WP_010714156.1.24064 WP_010714156.1.25180 WP_010714156.1.274 WP_010714156.1.28932 WP_010714156.1.31656 WP_010714156.1.32099 WP_010714156.1.33306 WP_010714156.1.33460 WP_010714156.1.33574 WP_010714156.1.34192 WP_010714156.1.35810 WP_010714156.1.35823 WP_010714156.1.36900 WP_010714156.1.39119 WP_010714156.1.42483 WP_010714156.1.43903 WP_010714156.1.44185 WP_010714156.1.44242 WP_010714156.1.46056 WP_010714156.1.46348 WP_010714156.1.47407 WP_010714156.1.47856 WP_010714156.1.47867 WP_010714156.1.49131 WP_010714156.1.52926 WP_010714156.1.55065 WP_010714156.1.57048 WP_010714156.1.57136 WP_010714156.1.57542 WP_010714156.1.58620 WP_010714156.1.59698 WP_010714156.1.59964 WP_010714156.1.60361 WP_010714156.1.60394 WP_010714156.1.61083 WP_010714156.1.63148 WP_010714156.1.63848 WP_010714156.1.63884 WP_010714156.1.66316 WP_010714156.1.66898 WP_010714156.1.77328 WP_010714156.1.78503 WP_010714156.1.78641 WP_010714156.1.80104 WP_010714156.1.80452 WP_010714156.1.81327 WP_010714156.1.81575 WP_010714156.1.82993 WP_010714156.1.83490 WP_010714156.1.8380 WP_010714156.1.84260 WP_010714156.1.90371 WP_010714156.1.90503 WP_010714156.1.90872 WP_010714156.1.91394 WP_010714156.1.95534 WP_010714156.1.9570 WP_010714156.1.96481 WP_010714156.1.96745 WP_010714156.1.97078 WP_010714156.1.98868 WP_010714156.1.99 WP_010714156.1.9925 WP_010714156.1.99432 gi|29374718|ref|NP_813870.1| 226185.EF0062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]