SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320116728|ref|YP_004186887.1| from Thermoanaerobacter brockii subsp. finnii Ako-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320116728|ref|YP_004186887.1|
Domain Number 1 Region: 534-849
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.98e-78
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00048
Further Details:      
 
Domain Number 2 Region: 33-341
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.22e-72
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00048
Further Details:      
 
Domain Number 3 Region: 340-531
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 5.36e-54
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000424
Further Details:      
 
Domain Number 4 Region: 850-1064
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.62e-47
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|320116728|ref|YP_004186887.1|
Domain Number - Region: 1123-1160
Classification Level Classification E-value
Superfamily SH3-domain 0.00114
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320116728|ref|YP_004186887.1|
Sequence length 1226
Comment 5'-nucleotidase domain-containing protein [Thermoanaerobacter brockii subsp. finnii Ako-1]
Sequence
MFRSRSRILAIFVGAIMVFSMFFSAVPQIAFAATSKTFDFIEVTDFHGYLQNDGKLSDGT
IYKQQIAGVLAKQIKDIKAQNPDRTVILSDGDMFQGTPLSNVLKGQPVIEMMKNIGFDAM
TLGNHEYDWGIDSVIDTQNATLKNSTIPVLAANVYDKTTGQPVNYVKPYVMIEKDGVKIG
IIGIVDNKEFPNIIMPAYIQNVEFKDPVPIVNDLAQQLRQQGAQIVVVLAHMGAYQDKSG
NATGNLIDFAKQVQGVDAIFGGHTHSIVTTRVNGIPVGVAYYYGRGFIDLKITLNNDGTV
TTGDMQYIDITGLYSTQNPVVDPEVQAIVDKAVQDVGPIFNEVIGQAAIDLTRTQSAQPY
GDSLLGNWAAQVTKDAVGADFGFANNGGLRIDIPKGDITVGMMYQLMPFDNTIVTMKMTG
AQVKTILEQAVQDGGKGIQVAGLTFKYDPSKPSMQRVFDMRKSDGTPILMDKTYLVATNN
FMGTGGDGFTGFTDPDVVKTYVDTYKLVRDAFIDAVKAQKTVTSKIDNRIAPAKMSDATI
AVLATSDIHGNIFPWDYNTAKPANQGLAKVSTYVKQVRAQYPYVVLVDNGDTIQGTPLSY
YYDKIDTTTEYPLAKVMGAMKYDTWTLGNHEYNYGLDVLNRVINDMRNEGIHVLSANTYK
DDGTNFVDPYYIKTFDTPQGPVKVGILGLTTKTIPSWEDKDHYAGLHFNDLVEEANKWVP
KLREAGADIVVVAMHSGEESPTDVIPENQVIAVATQVNGIDAIVAGHTHAIISQHTYKNP
AGETVIVTEPGKWGQYVSQINFNISKNADGKWVIDSKWSATIKMDDSVQADPDILNLAQP
YQDATLKYIGTKIGVATGDFLGTEQTVKETAIMDLINKVQKYYAKTDLSIAAPLSSSAKI
LKGDITIQDIMGVYVYENYLYGIKMTGKQLKDWLEWSARYYKQVSSPNDPITKDPTLNIP
DYNLDQLYGASYVIDLTQPAGHRIKNLKVNGKLVKDDDVFTVAINNYRFNGGGGFMQAAG
ITNPEIVFDSAKAYGDDGQVRNLMIRYIQEHGTITPTVEKYWYVSTTPVAEETPSPVTQP
TPAPTPQPQPAPQPVYNYGIVTASALNVRAGASTSSKIIGVLPAGKVVTLLEEVNGWYKI
DYNGKTGYIYGKYVAATPNPSKVTVLKAVKVTAKSGLNVRVGNSINAKKIGAVPYGTELK
VVGEYNGWYQIQYNGGFGYVYAKYTK
Download sequence
Identical sequences E8UQT4
gi|320116728|ref|YP_004186887.1| WP_013570844.1.56562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]