SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333897809|ref|YP_004471683.1| from Thermoanaerobacterium xylanolyticum LX-11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333897809|ref|YP_004471683.1|
Domain Number 1 Region: 537-852
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.76e-85
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 33-338
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.12e-69
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00081
Further Details:      
 
Domain Number 3 Region: 341-531
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 5.23e-55
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000497
Further Details:      
 
Domain Number 4 Region: 853-1068
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.57e-48
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|333897809|ref|YP_004471683.1|
Domain Number - Region: 1105-1139
Classification Level Classification E-value
Superfamily SH3-domain 0.000368
Family SH3-domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333897809|ref|YP_004471683.1|
Sequence length 1208
Comment 5'-nucleotidase [Thermoanaerobacterium xylanolyticum LX-11]
Sequence
MLKGRGKVLSIILTFVMVFGMVFSSMPQISYAATSKTFDFVEVTDFHGYLQASGKLSDGT
PITQERGSVLAKRIKDIKAANPDTVVLSGGDMFQGTPLSNVLKGQPVIDMMKSIGFDAMT
LGNHEYDWGIDSVIDTNNAVLKGSTIPVLAANVYDKTTGKPVSYTKPYVVIERDGVKIGI
IGIVDNKEFPSIILPSLISNVDFKDPVPIVNNLAQQLRNDGAQIVVVLAHMGATTDKNTG
ETTGNLIDFAKNVKGVDAIFGGHTHTIVTTRVNGIPVGVANNAGMGFIDLKIKVNSDGTV
SAGDMVYNDDYSYYNTKTPVVDEDVQSIVDKAIQDAGPLFSQVIGTADVDLTRTQSANPF
GDSILGNWTSEVVKNAVNADFAFGNNGGLRTDVLKGDITVGTMYTLMPFDNTIVTVSMTG
AEIKKVLEQAVQDGGKGIQVAGLSFKYDPSKPSMNRVFDMKKSDGTPIDMNARYLVATNN
FMGTGGDGFTEFTDPDVQKSYIDTQKLVRDAFIDAVKAQGHITAKIDNRISPATMIASNE
TTITVLATSDVHGNLVPWDYSSAKEANQGLAKVAGYVDQVRSENPNVVLVDNGDTIQGTP
LSYYYDKIDTKSEYPMAKAMGAMHYDTWTLGNHEFNYGLDVLNRVIADMEKENIHVLSAN
TYKDDGTNFVEPYYIKTITTPMGDVKVGILGLTTKEIPSWEDKSHYAGLKFNDLVEEANK
WVPKVRAAGADIVVVAMHSGEESPSDTIPENQVKAVAQGVNGIDAIIAGHTHAVIQMDTF
KNPEGKDVIVTEPGKWGQYVSRIDFNLSKDENGKWTIDSKTSKAVAMGSSVQPDENIMQL
AEPYQEATLKYVGTKIGTASGDFLGKDQLTKETALMDLINKVQKYYAKTDLSIAAPLSST
AQILKGDVTIQDMMSVYVFENYLYGIKMTGKQLKDWMEWSARYYQQVKSPDDPITKDKTL
NIPDYNLDQLYGASYTIDLTQPVGNRIKNLTVNGKPVKDDDVFTVAINNYRFNGGGGFMK
AAGITNPVIVFDSAKAYGDDGQVRNLMISYIKMKGTIDPVVDNYWTISKTPVLEGNVGSK
GIVTASALNVRSGAGTNYKVIGVVRAGQSINIIGENDGWYQIEYNGKTGYVYGKYVASSP
DLTNVAVLKSVKVTAKDGLNIRVNNSINALKIGAVPYGYELKVVGEYDGWYKVLYNGVYG
FVYAKYTK
Download sequence
Identical sequences F6BJZ0
WP_013788741.1.39170 gi|333897809|ref|YP_004471683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]