SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CIST_06301 from Coccidioides immitis RMSCC 3703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIST_06301
Domain Number 1 Region: 56-303
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 6.54e-53
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00055
Further Details:      
 
Domain Number 2 Region: 29-59
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.0000329
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CIST_06301
Sequence length 307
Comment | CISG_06276 | Coccidioides immitis RMSCC 3703 conserved hypothetical protein (308 aa)
Sequence
MLKSLTAVLVGLAGSVLGTQPNAPDPIPAPLRNLTWGQLNFLHTTDTHGWLAGHLNEIYG
CSPENLWMSRAKYPSQSSIYTWLEEKVLPDTLRGDRPAMAILNTGAIRFDLFKGRVTEES
AYNLSPFTGGFRFTKNVPYDKSIKILEVLNKAPRIFSQQPGVPSSALLVSPEQLATSGDI
KSPLRHNQVPFEVSDFSSHEMDLIPGYTTQDAAGNDGDDTIHSPICFYRLPNCIQAFIPV
VKEEKRTVKPDTVDLVYLEFIEPFIDVAAKFVGLDFDVKRDTAEYKPGSSLRSIIVDWVE
HNWKCEG
Download sequence
Identical sequences A0A0J8QX73
CIST_06301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]