SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000007018 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000007018
Domain Number 1 Region: 3-222
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.39e-61
Family Ankyrin repeat 0.0000345
Further Details:      
 
Domain Number 2 Region: 836-974
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-35
Family Phosphotyrosine-binding domain (PTB) 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSTSYP00000007018
Domain Number - Region: 665-693
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000167
Family SAM (sterile alpha motif) domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000007018   Gene: ENSTSYG00000007562   Transcript: ENSTSYT00000007660
Sequence length 1066
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_522:3486:124521:1 gene:ENSTSYG00000007562 transcript:ENSTSYT00000007660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGPNVNCVDSTGYTPLHHASLNGHKDVVEVLLRNDALTNVADSKGCYPLHLAAWKGDA
QIVRLLIHQGPSHTRVNEQNNDNETALHCAAQYGHTEVVKVLLEELTDPTMRNNKFETPL
DLAALYGRLEVVKMLLNAHPNLLSCNTKKHTPLHLAARNGHKAVVQVLLDAGMDSNYQTE
MGSALHEAALFGKTDVVQILLAAGIDVNIKDNHGLTALDTVRELPSQKSQQIAALIEDHM
TGKRSAKEVDKTPTPQPLLISSMDSVSQKSQGDAEKAATDLVIDFDTNAEEEGPYEALYN
AVSCHSLDSMASGRSSDSMNKEVEAAGVKTAGVRPRERPPPPAKPPPDEEEEDHIDKKYF
PLTASEVLATRPRIQGSAAREEDEHPYELLLTAETKKPVSVDGKTKDYRRSSSSRSQDSA
EGQDGQVPEQFSGLLHGSSPVCEVGQDPLQLLSATSQSHPDGSPQQGACHESSMQLEKTD
VHTPGASQPSVPDQSKGVGCPAGLPTTNSRSHPATLTHVASLHPGGAEEGDRSGARSRAP
PTSKPKAELKLSRSLSKSDSDLLTCSPTEDTTMGSRSESLSNCSIGKKRLEKSPSFASEW
DEIEKIMSSIGEGIDFSQEQQKISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
GSNVMEEQDLREIGISDPQHRRKLLQAARSLPKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
CQDLLSQTSSPLSQNDSCTGRSADLLLPPADTGRRRHDSLHEPAASSRMERFRIQEEHRE
AKLTLRPPSLAAPYAPVQSWQHQPEKLIFESCGYEANYLGSMLIKDLRGTESTQDACAKM
RKSTEHMKKIPTIILSITYKGVKFIDASNKNVIAEHEIRNISCAAQDPEDLCTFAYITKD
LQTSHHYCHVFSTVDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXLEPPDVDQDAQSHASVSWVVDPKPDSKRSLSTN
Download sequence
Identical sequences ENSTSYP00000007018 ENSTSYP00000007018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]