SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317127244|ref|YP_004093526.1| from Bacillus cellulosilyticus DSM 2522

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317127244|ref|YP_004093526.1|
Domain Number 1 Region: 534-806
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 5.4e-79
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 55-326
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.64e-76
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00037
Further Details:      
 
Domain Number 3 Region: 806-996
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 9.94e-40
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00027
Further Details:      
 
Domain Number 4 Region: 328-515
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.44e-39
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00016
Further Details:      
 
Domain Number 5 Region: 1010-1194
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.57e-30
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317127244|ref|YP_004093526.1|
Sequence length 1485
Comment LPXTG-motif cell wall anchor domain-containing protein [Bacillus cellulosilyticus DSM 2522]
Sequence
MFLKKTWSKGIIYWMILALVFSIVTPIQTVSASSNDDIVTLESTTEDNVTTGNEDLLDLT
ILHTNDIHSRIDELGKAAAFINAEREAAENSLYLDAGDIFGGSPVNDINLGEPIIEILNE
MNLDALTIGNHEFDYGQDAFADRVIQSDFPWISANMTVSPEIPIEQPDPYTIFEFDDFDV
AVFGLTQNPPATAPSGIVGIEFHNYVETALQYQDEMEAQADIIIALTHIGNSADRRLAES
VDYFDVIIGGHSHSVINSPQVVNGTPITQAGGYASHVGKLNLSIDPETKEVVDVTGHLQS
IDQLTETEENIQSIIDSWNIQMEDILQITIGESDTGLTRDGRNSRDIALGNFWTDAMVWA
TEADMAFTNNGGVRDSIEPGAITIGDIYRVEPFDNQVMLYEMTGQAIKDVIQYSYSRFRN
VDLQTSGLHYTILTDENRYYSDAILELNGEPLNMEQTYIVALPDFIGTGGSGYHFVGEVI
YPEVMPVTTAMIQYAEFLTEQGKRLNYESEGRISIILHSELEPTNPEPNDPPNSEVLDLT
ILHTNDIHSRIDELGKAAAFINAEREAAENSLYLDAGDIFSGSPVNDINLGEPIIEILNE
MNLDALVIGNHEFDYGQDVFAERVIQSDFPWISANMTVSPEIPIEQPDPYTIFEFDDFDV
AVFGLTQNPPATAPSGIVGIEFHDYVETALQYQDEMEAQADIIIALTHIGYGADRSLAEE
VDYFDAIIGGHTHTTLSTPQVVNGTPITQAGGYASHVGKLNLSIDPETKQVIEVSGGLQE
ISSLSEVDEDVQAIVDHWNEQMDEILSIVIGETETGLSRNERYETDAPLGNFWTDAMAFA
ASADIAFTNNGGIRDSISPGDVTIGDIYRIEPFDNQVMLLEMTGEAIKNVIEYSYTRDGR
NQIDLQSSGLHYTILTNSSGQYIDAILEINNEPINMNASYLVAVPDYIGTGGSGYHFEGE
VLYNEVTPMTTAMIDYAEYLGLQGQKLNYHIEGRINIKIDPNADTPDGNTIGATTNGLYS
DNKSAMDVGLGNLYADAVRSIANADIGLLNGSSVSGNIPAGDITIEQIEQLDRFGNEIVL
VETTGAQLKEMILSQSNFHRNVDLQASGIHYILVKGDGPQTFSDVSIYLEDGTPIIEDAV
YTVAYNDFMHNGGHYTLSNETIEIEPITVWEAVVEYVKAQEGPIDYVEGSRIYVEILAHP
RVEEETIFISDDIVDKITKNSVLAINLHSDEFSSISKITFSQSQIDALRENNVNVYITTD
FFTISFPAAMFSSGEVEFSFENVNEEEIDLTKIDEIGHLLSKVYNFTFLHNGQPFTQFGE
YDVTLKLPLVHEFDNEENVSVYFYDKSEEQWTSIGGTLDNGVIQAQTNHFSMFAAFEFFE
GTEQEPIDPVDPVDPIDPVDPIDPIDPIDHVDSTDSVDQNPEQDGSKESDKEDDIEKKIV
EDEKKGSNKTLPDTATDVYQWLLAGLLLIFLGISLTLIRNRHKTV
Download sequence
Identical sequences E6TXI1
WP_013487136.1.80543 gi|317127244|ref|YP_004093526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]