SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071685 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071685
Domain Number 1 Region: 536-979
Classification Level Classification E-value
Superfamily RNI-like 6.28e-74
Family 28-residue LRR 0.0000163
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-23
Family Pyrin domain, PYD 0.012
Further Details:      
 
Domain Number 3 Region: 135-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000863
Family Nucleotide and nucleoside kinases 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071685   Gene: ENSMUSG00000054102   Transcript: ENSMUST00000071780
Sequence length 1004
Comment pep:known chromosome:GRCm38:7:26535065:26574144:1 gene:ENSMUSG00000054102 transcript:ENSMUST00000071780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDSSGYGLLQYLQKLSDEEFQRFKEHLRKEPEKFKLKPISWTKIKNTSKEDLVMQLYTH
YPGKAWDMVLSLFLQVNREDLSTMAQTERRDKQTKYKEFMKNTFQHIWTMETNTYIPDRS
YHEFIEVQYRALQDIFDCESEPVTVVVSGSRGGGKTTFLRKAMLDWASRNLLQNRFQYVF
YFSVFSLNNITELSLAELISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNL
CNDWRKKLPIQIVLSSLLQKIMLPECSLLLELGNASLSNIIPLLQYPREIIMSGFSEQTI
EIYCVSFFNTQTGVEIFKNLKSIKPLFNLCRCPHLCWMICSTIKWQYERREVASRFGRTL
GLLYTIFMVSAFKSTYARNPSKQNRARIRTLCTLAVEGMWKQVYVFDSDDLRRNGISESD
KKVWLRMKFLQNQGSNIVFYHSTLQWYFAVLFYFLQYKDTRHPVIGNLAQLLGEIYAHKQ
NQWFHTRILLFGMATEQVNSLLEPCFGCISSKEVRQEIIRYIKSLSQQECNEKLVVHPQN
LFFCILDNQEERFVRQLMDRFEEMTVDISDVDDMSATPYCLHRAPKVKNLHLHIQKRVFL
EIHDPEYGDLELFKLDQKLLAKHWTTLCTFLCNLHVLDLDSCHFNEKAIEVLCNCLPLTS
LVPLTGFKLHRLLCSFTTNFGDGLLFCTFLHLPHLKYMNLYGTNLSNDAVERLCSALKFS
TCGVEELLLGKCDISSEACGIIAASLINSEVKHLSLVENPLKNKGVMSLCEMLKDPSCVL
ESLMLSYCCLTFIACGHLYEALLSNEHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKEL
WLPGCYLTSECCEEISAVLTCNTNLKTLKLGNNNIQDTGVKRLCEALCHPNCEMQCLGLD
MCDFTSDCCEDLALVLTTCNTLKSLNLDWNAFDHSGLEMLCKALNHKACNLEVLGLDKSL
FSEESQTLLQAVEKKNKNLKVLHFPWLKEELEKRGVRLVWNSKN
Download sequence
Identical sequences D3Z7F5
ENSMUSP00000104024 ENSMUSP00000104024 10090.ENSMUSP00000104024 ENSMUSP00000071685 NP_001041684.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]