SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000072895 from Mus musculus 69_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000072895
Domain Number 1 Region: 535-977
Classification Level Classification E-value
Superfamily RNI-like 4.93e-74
Family 28-residue LRR 0.0000237
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-21
Family Pyrin domain, PYD 0.0094
Further Details:      
 
Domain Number 3 Region: 126-285
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000958
Family RecA protein-like (ATPase-domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000072895   Gene: ENSMUSG00000060508   Transcript: ENSMUST00000073151
Sequence length 1003
Comment pep:known chromosome:GRCm38:7:20008023:20062940:1 gene:ENSMUSG00000060508 transcript:ENSMUST00000073151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSGYGLLKLLQKLSDEEFQRFKELLREEPEKFKLKPISWTKIENSSKESLVTLLNTH
YPGQAWNMMLSLFLQVNREDLSIMAQKKKRHKQTKYKKFMKTTFERIWTLETNTHIPDRN
YHLIVEVQYKALQEIFDSESEPVTAIVAGTTGEGKTTFLRKAMLDWASGVLLQNRFQYVF
FFSVFSLNNTTELSLAELISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNL
CNDWRKRLPTQIVLSSLLQKIMLPGCSLLLELGQISVPKIRHLLKYPRVITMQGFSERSV
EFYCMSFFDNQRGIEVAENLRNNEVLHLCSNPYLCWMFCSCLKWQFDREEEGYFKAKTDA
AFFTNFMVSAFKSTYAHSPSKQNRARLKTLCTLAVEGMWKELFVFDSEDLRRNGISESDK
AVWLKMQFLQTHGNHTVFYHPTLQSYFAAMFYFLKQDKDICVPVIGSIPQLLGNMYARGQ
TQWLQLGTFLFGLINEQVAALLQPCFGFIQPIYVRQEIICYFKCLGQQECNEKLERSQTL
FSCLRDSQEERFVRQVVDLLEEITVDISSSDVLSVTAYALQKSSKLKKLHLHIQKTVFSE
IYCPDHCKTRTSIGKRRNTAEYWKTLCGIFCNLYVLDLDSCQFNKRAIQDLCNSMSPTPT
VPLTAFKLQSLSCSFMADFGDGSLFHTLLQLPHLKYLNLYGTYLSMDVTEKLCAALRCSA
CRVEELLLGKCGISSKACGIIAISLINSKVKHLSLVENPLKNKGVMSLCEMLKDPSCVLQ
SLMLSYCCLTFIACGHLYEALLSNKHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKELW
LPGCFLTSQCCEEISAVLICNRNLKTLKLGNNNIQDTGVRQLCEALSHPNCNLECLGLDL
CEFTSDCCKDLALALTTCKTLNSLNLDWKTLDHSGLVVLCEALNHKRCNLKMLGLDKSAF
SEESQTLLQDVEKKNNNLNILHHPWFEAERNKRGTRLVWNSRN
Download sequence
Identical sequences Q66X22
ENSMUSP00000072895 ENSMUSP00000072895 NP_918947.2.92730 XP_006540001.1.92730 XP_006540002.1.92730 ENSMUSP00000072895 10090.ENSMUSP00000072895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]