SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006324 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006324
Domain Number 1 Region: 1-197
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-52
Family Ankyrin repeat 0.0000659
Further Details:      
 
Domain Number 2 Region: 812-973
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-44
Family Phosphotyrosine-binding domain (PTB) 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000006324
Domain Number - Region: 601-668
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00014
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006324   Gene: ENSMEUG00000006919   Transcript: ENSMEUT00000006954
Sequence length 1041
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_645:7682:80914:1 gene:ENSMEUG00000006919 transcript:ENSMEUT00000006954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVVEVLLRNDALTNVADCKGCYPLHLAAWKGDAQIVRLLIHQGPSHTKVNEQNNDNETAL
HCAAQYGHTEVVKVLLEELTDPTMRNNKFETPLDLAALYGRLEVVKMLLNAHPNLLSCNT
KKHTPLHLAARNGHKAVVRVLLDAGMDSNYQTEKGSALHEAALFGKTDVVQILLAAGIDV
NIKDNRGLTALDTVRELPSQKSQQIAAFIEEYMTGKRSTKGDKAIRAQPPFIPNVDSASL
KSQXXXXXXXXXXXXXXXXXXXXXXXXXXLYNAVSCHSLDSMTSGKSSDRESVTKETEAA
VVKASGVRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPVMRSRSQGSAPKEEDEHP
YELLLTAETKKLVSLEGKTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
RMLEQSVGEWLESVGXXXXXXXXXXXXXXXXXXXGSNVMEDQDLRDIGISEPQHRRKLLQ
AARSLPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVL
KVHLLGHRKRIIASLADRPYEEPPQKPPRFSQLRCQDLISQTSSPLSQNDSCTARSXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDPREAKLTLRPPSLAAPYAPVQSWQHQPE
KLIFESCGYEANYLGSMLIKDLRGTESTQDACAKMRKSTEQMKKIPTIILSITYKGVKFI
DASNKNIIAEHEIRNISCAAQDPEDLCTFAYITKDLQTSHHYCHVFSTVDVNLTYEIILT
LGQAFEVAYQLALQAQKSKTGGASAAEMIETKASKPVPKPRVGMRKSAMEPSDTDQDTQS
HASVSWVVDPKPDSQRSLSTN
Download sequence
Identical sequences ENSMEUP00000006324 ENSMEUP00000006324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]