SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010159035.1.22856 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010159035.1.22856
Domain Number 1 Region: 679-919
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-55
Family Protein kinases, catalytic subunit 0.00000132
Further Details:      
 
Domain Number 2 Region: 151-248
Classification Level Classification E-value
Superfamily Cadherin-like 0.000002
Family Cadherin 0.0036
Further Details:      
 
Domain Number 3 Region: 16-94
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000542
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_010159035.1.22856
Sequence length 919
Comment PREDICTED: proto-oncogene tyrosine-protein kinase receptor Ret [Eurypyga helias]; AA=GCF_000690775.1; RF=representative genome; TAX=54383; STAX=54383; NAME=Eurypyga helias; AL=Scaffold; RT=Major
Sequence
MVLLIMVDGKTAFGLYFPRKEYSENVYIDQPAGTPLLRIHAMRDSHGEVAHFHLCQNLII
SRARSHENHWFQIRERTGLLYLSKSLDREDFNMLSVGNWMPLSKVMLYVFLSSHPFQEKE
CDSAMRTTVFLSLINATAPACSSLTARQLCFTEMDLSFHIKENKPPGTFHQLQLPLVPHL
CQNLSISYKLLAAEGMPFRYNENTTGVSVTQRLDREERERYELIAKCTVREGFREMQVEV
PFLVNVLDEDDSPPFLPNGTDTADAVVEFNRKEGTVLATLTVYDADTTPIYPLESSRKKY
TGTIITDDPWISETFRVEHIFDEIHFSPNGSQVRGTQHEYKLVLNKSISVTEHRSFQLDV
LVNDTEFHGPERSLMLHFNVSILPVSIQFPNMTYQFTVNRNAERFAQIGKICIENCLKFR
GVNITYKLLSLNVSCYPVSILQGREDKYGSLYVNDSSVLRRPECKEIQYTIQATDKQSRK
HAKTLLTIVLEGTLLKEEDCPDSCAVSKHRAECEECGGLGVLTGRCQWRQGSGKGITTNY
STCTPSIKTCPDGTCDAVESKDPSVCPQDCTSGDIIGGHGKGTGNLGIKSGHGICYCFPR
QNCYCEKDDIKEQLCDEVCKTVIAGAVLLSFIISVLLSSYFIHRYHKNSPKPPIASAEMT
FRRPAPSYPISYSSTNVRRPSLDSMENQVSVDTFKIPEDPKWEFPRKNLVLGKTLGEGEF
GKVVKATAFRLKGRAGYTTVAVKMLKENASQSELRDLLSEFNLLKQVNHPHVIKLYGACS
QDGPLYLIVEYAKYGSLRSFLRESRKVGPSYVGSDGNRNSSYLDNPDERALTMGDLISFA
WQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRSKGRIPV
KWMAIESLFDHIYTTQSDV
Download sequence
Identical sequences XP_010159035.1.22856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]