SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_010173247.1.30499 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_010173247.1.30499
Domain Number 1 Region: 669-955
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.7e-71
Family Protein kinases, catalytic subunit 0.000000122
Further Details:      
 
Domain Number 2 Region: 140-237
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000257
Family Cadherin 0.005
Further Details:      
 
Domain Number 3 Region: 5-83
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000757
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_010173247.1.30499
Sequence length 955
Comment PREDICTED: proto-oncogene tyrosine-protein kinase receptor Ret, partial [Antrostomus carolinensis]; AA=GCF_000700745.1; RF=representative genome; TAX=279965; STAX=279965; NAME=Antrostomus carolinensis; AL=Scaffold; RT=Major
Sequence
AFGLYFPRKEYSENVYIDQPAGTPLLRIHALRDSHGEVAHFHLCQNLVISRARSHENHWF
QIREKTGLLYLSKSLDREDFSMLSVGNWMPLSKVMLYVFLSSHPFQENECDSATRTTVFL
SLINATSPACSSLTARQLCFTEMDLSFHIKENKPPGTFHQLQLPSVHHLCQNLSISYKLL
AAEGMPFRYNENTTGVSVTQRLDREERERYELIAKCTVREGFREMQVEVPFLVNVLDEDD
SPPFLPNGTDTADAVVEFNRKEGTVLASLTVYDADTTPIYPLESSRKKYTGTIITDDPWI
SETFRVEHIFDEIHFSPNGSQVRGTQHEYKLVLNKSISVTEHRFFQLDVLVNDTEFHGPK
RSVMLHFNVSILPVSIQFPNMTYQFTVNRNAERFAQIGKICIENCMKFRGVNITYKLLAP
NISCYPVSILQGREDKYGSLYVNDSSVLRRPECKEIQYTVQATDKQSRKHTKTLLTIVLE
GTLLKKEEDCPDSCAVSKHHAECEECGGLGVLTGRCQWRQGSGKGITTNYSTCTPSIKTC
PDGICDVIESRDLAVCPQDCTSGNIIGGHGKGAGNLGIKSGHGICYCFPRQNCYCEKDDI
KEQLCDDVCKTVIAGAVLLSFIISVLLSSYFIHRYHKNSPKPPIASAEMTFRRPAQSYPI
SYSSTNVRRPSLDSMENQVSVDTFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFR
LKGRAGYTTVAVKMLKENASQSELRDLLSEFNLLKQVNHPHVIKLYGACSQDGPLYLIVE
YAKYGSLRSFLRESRKVGPSYVGSDGNRNSSYLDNPDERALTMGDLISFAWQISRGMQYL
AEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFD
HIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLFNLLKTGYRMERPENCSEEM
Download sequence
Identical sequences XP_010173247.1.30499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]