SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bmb003085 from Bombyx mori

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bmb003085
Domain Number 1 Region: 568-788
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.62e-52
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0000957
Further Details:      
 
Domain Number 2 Region: 155-384
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.09e-49
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 787-930
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 3.4e-32
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00033
Further Details:      
 
Domain Number 4 Region: 382-570
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 4.32e-29
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bmb003085
Sequence length 931
Sequence
MSRVVSRVGLSRCRVSRAFPPTELEKELDEDVKRCVYMETDAEGFILPVGGLSAAKLVVG
ARLAPDVHARNAVLSVVSRENLSLQIRIEADIPPHHELLLWPDEQLSAIAAVPFLTPKNI
FGNCFFLAYEFLTQLIATLAVVTLTGCSVARTNKDGTFELLILHNNDMHAKFEQTSQLSG
VCTEADRNAGKCYGGFARVAYLVKQARKAAQTGEGPPVLYLNAGDTYTGSPWFAQYKWKI
AAEFINALQPDAVSLGNNEINETGKLSPLLQTIQTNITISNVILKSAEQNENFHKSIIVD
VNGVKIGLIGYLTPDTELLKHTEEVEYIDELVAIRDEVLNLQKRGVKIIIVFGHSNLNKA
IEIAKEIDGVDFVISGHKKLFFWNDAMMYYHALRFDGTQPWTDAPIAIIHGGAIAASIAP
ANRPAPIIRSDLESVLPLESNVAAVTVTGNVLKEILEHSVADYNEENPSGRFLQFSGIRV
EYNIAREPGSRVVNAVARCGTCFVPEFYSIDDWRSYKILMPAALANGEFDYHMIKGLPRE
DYIYDEIASTSEFIRLRSPVYPEVANRISLGNHEFDNGVSGLTPFIQNVTCPVLASNLIL
TNEPSLEVESNLMKSIILDINGTKIGVIGYLTPDTKFTAIKNNIEYIEEIEAIKTEISNL
KKFNVEIFIGLGHSGFVKDLEIAKEVEDIDLIIGGHTNTFLWNGPAPDIEIPEGPYPTMV
KQKSGRLVPVVQAYYNTKYLGKLNLIFENGEIVRYEGNPIILDSTVPEDEDVLKIIQKYQ
ADMAKFLNVVVGSTTIILDSRKCQLKECNIGNLISDAMVEKYASEYNGDGWTDAPVAIIQ
GGGIRASVAHLNYPAEITKGDLLMVLPFDGNMMRVTLNGTTIKSMLEHCVANYEPMRRRG
RFLQMSGMNVVYDIENPPGNRLSEIYIRCSN
Download sequence
Identical sequences Bmb003085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]