SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pismi1|9329|gm1.3853_g from Pisolithus microcarpus 441 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pismi1|9329|gm1.3853_g
Domain Number 1 Region: 21-103,134-319
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.32e-45
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00000822
Further Details:      
 
Domain Number 2 Region: 351-588
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 7.59e-40
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00056
Further Details:      
 
Domain Number 3 Region: 829-920
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00000000000000772
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0047
Further Details:      
 
Domain Number 4 Region: 583-666
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.0000036
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0019
Further Details:      
 
Weak hits

Sequence:  jgi|Pismi1|9329|gm1.3853_g
Domain Number - Region: 742-811
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.00588
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pismi1|9329|gm1.3853_g
Sequence length 947
Sequence
MVGDQAWSTSYAEACTWKSTYAIFHSSGDLGDFASFVTHMKQIAIEKNVDLPLVDSGDIH
DGTGLSDGYPPGGVDAHESNKFLERLPYDLMAIGNHELYVYADTYDMYVPTILLVVASSS
PTDVRYFSRPIVSWSNRYTNFVPQLHGRYLSSNVNITVFSSDGEAVSVPVGNRSVKFTTA
KGRRVTSVGVLYDFTGNSVNTTVQFVADMVKESWFVEAIEEEPDVFVLVGHMPVSYDNWP
VVFDAIRAVHPLTPILIFGGHTHIRDCQQYDGRSMALESGRYMETIGWMSANLSAAQGNS
NNISFTRRYLDQNRVTYQYHTLTSNATFDTSYGHSITVGLEDLAEQFNLSYLYGYAPQDY
TLSRNPYPSNGSVLSLFVDDAAPTALAINNSRAGIPNILITNSGELRFDVLKGEFTKNDQ
LTALPFTDSFLYIPNITLSIATQVLPALNGAGTSNKKKRAALEREMWRRGYVDGRYNTWL
AEMARRAGPGSTAEMAGSLTLGYVTTDSCPGAGDDTLHTAVPYYSSPDYIGSAIPNVTDD
TPVDLVFINFIVSDVIEVLNTLQSAKNYTDSDASLYSPVLANQVLGLYQSFIPHFEGRYL
TSNVNITVFDSDGKAVSVPVGSRYAKFTTAMGRRVTSLGVLFNFTGNTHNTTVQPVAKMI
EESWVDADVLAHQYLSRSHSSSLQKRLRRSPMSSSSWVSNDSSKCFKKEKSHWKDSRPFA
GPVVFNAILAMHLQPFRSGQDTHTRDCQQYDGRSMAMKSGRYMETIGWMSANLNTGKGNA
NDTEFSRRYLDQNRVTYQCHTRTFNSTFDTRYGRSITEGLRDLAEQYNLSYHDPYPSDGS
LLSLFIDGAIPTALKINNSRVEIPSLFISNSGDLCFDIFKGPFTKNDQLTAVPYPDQFLY
IPGVTFQVANQVLPALNKPSSTSLKQERAELEGKLWELGYVDDRFQT
Download sequence
Identical sequences A0A0C9Z907
jgi|Pismi1|9329|gm1.3853_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]