SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428303629|ref|YP_007119259.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428303629|ref|YP_007119259.1|
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000456
Family Tetratricopeptide repeat (TPR) 0.0063
Further Details:      
 
Weak hits

Sequence:  gi|428303629|ref|YP_007119259.1|
Domain Number - Region: 200-424
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000701
Family Trehalose-6-phosphate synthase, OtsA 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428303629|ref|YP_007119259.1|
Sequence length 466
Comment hypothetical protein Cri9333_4874 [Crinalium epipsammum PCC 9333]
Sequence
MDQLLNLDINSALTQFKLANAWQIQGKFEDAFIRYQETLRLQPDYLPAYQQLGNLMLKQR
RMDEALEYYEQALALDFEATNLSFYYQCLGLPKQHPAPSIKCENVSFGKEKSNALSTGKI
NLGSQKVFGYHRSGWSFAIQSLSSLHNPQGILFDGCLENQFLFQHNRVGKRSPRILAKMQ
ADGVFQSLATSEEKGIIPYQKPWIGFLHNPHSMPTWFNDQNSPQKLFEKATWQASLPHCV
GLFALSEHFAHWLREQTGKPVSVLTHPTEIPDKQFDFDQFLANHKKKIVQIGWWLRKLHS
IYQLPLAQDNPLNYQKVRLGFLFESGEAVFAQLMKREARIYKIQVDESYLANTTVIQHIP
DDQYDDLLSKNIAFVDLYDSSANNAIIECIARATPLLVNPLPAVKEYLGEDYPMYFHTLE
EAAEKALDISLILETHHYLKSCETREKLSAEYFLNSFCNSEVYQLI
Download sequence
Identical sequences K9W7B4
gi|428303629|ref|YP_007119259.1| WP_015180017.1.21814 gi|428303629|ref|YP_007119259.1|NC_019735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]