SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428303721|ref|YP_007140546.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428303721|ref|YP_007140546.1|
Domain Number 1 Region: 74-264
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.82e-40
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00049
Further Details:      
 
Domain Number 2 Region: 378-507
Classification Level Classification E-value
Superfamily TPR-like 4.14e-24
Family Tetratricopeptide repeat (TPR) 0.0081
Further Details:      
 
Domain Number 3 Region: 1-72
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000248
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428303721|ref|YP_007140546.1|
Sequence length 537
Comment chemotaxis protein CheR [Crinalium epipsammum PCC 9333]
Sequence
MNDNLLQRFLQLLVTQAGWQIRQQDQISLGHKIEFRVKALKLLNAEAYYQLLNAENEQSY
HEWRQLALLLTTTETYFFRDEGQFSLLRNKLIPELIEQKRKKQVLNGESKPTLRIWSAGC
STGEEPYSLAIMLTQLIPDWESWNLYLIGTDINLNALEKAKHGIFTSWSFRQVNPEVQKR
YFSPWKGDWKLDVKIRSMVNFEYGNLVKNSYPNNNSIYDMDLIICRNVFVYFDSNSIGVV
LNKFAKSLNLTGYLITGHAELYGQGLNLLKSQVFPESVVYQRRDHVVTSSQVKEVNRSNS
DSFNNINSPQKLDLFANNDTKLGNNSLSQIKSDYNKYPTQKLQPNISNIPNINQPKVVDL
QAGNNSDRTISQVTVDTIIEQVQVLVKNKNYLKAISELEEILAQYPNNFNIYYLLAKVYA
DLGKYPQAKKYCEQALSVDSRNIMPHYILANIAEEQSNITEAKVILKRIIYLAPDSISAY
LELASIYQQEGDITRCVKMRNVALDFLKKLPTNATVEPQGEITVAELINQLEELLNI
Download sequence
Identical sequences K9VT03
gi|428303721|ref|YP_007140546.1| WP_015201180.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]