SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428303810|ref|YP_007140635.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428303810|ref|YP_007140635.1|
Domain Number 1 Region: 588-712
Classification Level Classification E-value
Superfamily TPR-like 9.87e-33
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 
Domain Number 2 Region: 738-925
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-20
Family Nitrogenase iron protein-like 0.0039
Further Details:      
 
Domain Number 3 Region: 947-1032
Classification Level Classification E-value
Superfamily Hypothetical protein YjiA, C-terminal domain 0.000000000000968
Family Hypothetical protein YjiA, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428303810|ref|YP_007140635.1|
Sequence length 1035
Comment cobalamin synthesis protein P47K [Crinalium epipsammum PCC 9333]
Sequence
MVLQWSKKLIESIESSLQLMYCPQNLTVAISNLSKQTDPKFKPELIRQQFHIRQQEKQQQ
FQYQLEQARLQGQTNLQQIQQQFLDDLENERQSFEVKLLKAQLLHEYYLQKKYEDPQLQS
LKQSFDVAVMQAKLDVSRLEEVAAFSEYWQNLNLNNRHKVEELLPLERKKSEWDLKLYDR
EIQMLIAERHLQALLVGAEFQKILENHPLVSQCTPTLDFYKQYRDGSRPIPPLILIWPPT
LEPDEFPYAARGVGKIAAKLTDELRDFLSVNYDLHSQERPTKLLDGAYKTKQFQSEAALE
SLHWTHKSIPTLILESKIDGDAIRLYVGWWDMMETTHHYKKVISIPWKEILYPLVREKTL
RWKQYRLMLLKKGKTLAEIQRRGGEHEINLGILEAEEEDQEIDWNQEYNYYVNFEEYWSG
IADLLVFCHAIIAGLAVDQYYLHHYNVRPKLPEILPSFLEEFPNEELSEQLIQVVVATYK
QVYETLKQRQPDTIPELALDLAQVLTYLDDKSWMRGQLNYALQSWLQLRGVIPPANILDQ
ISNNLRGDQEITNSLLDLMQSLLYPVDTQYVGRVNQCLSILSDNRSLNLIDAFYYRGINY
AQEGNYPVAIDELTQVIKLQPDWAQAYYNRGLAYVQLEEYQQALEDYTQVLWLDYNHAEA
YEQRGNVFHKLGEYEKAIADYNQAIKLNPNLVEAKTNKDIAQEALIEVKRQYQIVAIRDQ
NLHNLQTIIANFPPIGLPVTIITGKNGSGKTTLLQEIIKKQTDLKLAILINEEGNVSIDK
MPRVYTKNLDTWTYQPRNRANYQRFIQFIYEILDRQNSVDHLVIETSGEADLLQLILAFV
DTDLKYRTHVNSVITVVDSEKFITYQLKDEASKNQIIYSDIILLNKADLVLEDKLRQVER
IISESKNTAKTLRCKYAKLPLPLIFDLGLNKIGLNRGYLDDNSLSLFSYQSDAAFDMKKF
EVFLDKQLPTNVFWGKGILLFEQSPKCHGFLLSGKRFSLYHERWKQQPENRLILIGENLD
NEWLSYRLNDCRSEV
Download sequence
Identical sequences K9VVD6
gi|428303810|ref|YP_007140635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]