SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428303827|ref|YP_007140652.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428303827|ref|YP_007140652.1|
Domain Number 1 Region: 425-660
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000794
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Weak hits

Sequence:  gi|428303827|ref|YP_007140652.1|
Domain Number - Region: 334-380
Classification Level Classification E-value
Superfamily Ferritin-like 0.0419
Family Ferritin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428303827|ref|YP_007140652.1|
Sequence length 740
Comment hypothetical protein Cri9333_0142 [Crinalium epipsammum PCC 9333]
Sequence
MIVTDSSTQKVSGWNIENYQRLRRVLSLGLRRQILVSVCDDFSLRNHLAEKLTTELAAPS
AESLSGVANGELITLQLNPSNPNFLAHIAQWITQHQQLERSLYTFQILGVELLTRQSADI
QRSFLRCLQVIGRNFPRLEASLLIWLPRPWFYTIQESVPEFWQWHTGLFEFEGEPTSLTK
ISNPQPEAKRRLETSLTEVEETPVAQEKVWQILTRDLANFSENNQEVPVTQKALEEQLTE
TNEHNAEKDIVLSNNFYIDDVDGSIKQEELTSPSSLAIINQNYSLSSLVDETEESKNLSL
YESTVVSSNDVQQTVGQDLLHPLTIHEISRSQQQEESPEAIAEAYLSVGNHYRDRIEEGD
VTSSNLMEAIKAYEEALIWLEKQASPIVPEVINDIANLYWMLSRFTDITLETGEPAVLNF
LQRSIESYQLALSKISGDNSHTCAMILNNLGAVYNDLAGYQDTADNLQLSIEAYQAALRY
RPAEDDPLKYASTQNNLGTAYWHLAQQVDQQLCVQLLQQAIASYTEAFNYYNPKEEPLNW
AMIQNNLGTTYWNLAQYEQSTTFLELAIKAYHQALKYRRADLAPAACAATQNNLGTAYWH
IAKYYQDTPEVWMQYIEKCIVAYQIAIALAQQLANSTPTEQLTFDVVSTQNNLGLAHYQL
ATHQKLSLSDQAKSTHLQAALAQNLQALQSLSDQPEHRTNSLNYVIKTIKAFYQQLGLQG
QNMALSKVPGYLLPEILPKL
Download sequence
Identical sequences K9VUJ8
gi|428303827|ref|YP_007140652.1| WP_015201286.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]