SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428303908|ref|YP_007140733.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428303908|ref|YP_007140733.1|
Domain Number 1 Region: 1209-1543
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.58e-98
Family WD40-repeat 0.00000597
Further Details:      
 
Domain Number 2 Region: 1519-1672
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.01e-45
Family WD40-repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 1089-1247
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.16e-41
Family Quinoprotein alcohol dehydrogenase-like 0.017
Further Details:      
 
Domain Number 4 Region: 535-752
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000217
Family G proteins 0.033
Further Details:      
 
Domain Number 5 Region: 309-498
Classification Level Classification E-value
Superfamily TPR-like 0.0000118
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428303908|ref|YP_007140733.1|
Sequence length 1700
Comment WD-40 repeat-containing protein [Crinalium epipsammum PCC 9333]
Sequence
MNSDANILPMTLNASEEVAALNERSLKTLSRAITLSEGSFSLILVRCNYVALKAQMWHRL
KESCGIKLQKLVLPQCAKTLFTTIKPEIALSPPPALMIFGLESVTSIDQLLVSTNQLRDE
FRTHFPFPLVLWITEEVLQKLTRLAPDFKSWAASSIKFELNPNELNALWHQLTDGLFRYL
LIAGASKFVPNQALDMAPGGRKRQELESVRRELYSSGMQPPRALEGTYQFVLGRDAYGCD
RIDVALEHYQNSLDYWEQQDQTQGENQQDLTLSCEQVPSNHSCCERQGILLFHLGLCYRR
LADLEPAKSSNHWQAAKDFFFAAVKVFEGQERHQIVAQLITQAGEVLRHLEAWKELQTLA
LESLTRLETYNSPLQLAQANGFLAEVALKASKPVEAYQAAQTALFILANFIGDSQTGTEK
PLHHRSLYLLLLAKAERQMDQHFVAMTHLEQAHEDTEPQYEPQIYLDILEELRSLYFEQG
RYLQAFEIKQEQRSIKQQYGFSTFVGASPLQPQRRPTGITGNNHVQVAQEIIAADRTKDV
QQLISRISRNDYKLIIIHGASGVGKSSLINAGLVPTLANRVIAAKKALPVVQRVYTDWVV
TLGRSLESSLINVGYSLVSPRDQLNSLAGIVRELRILASRNILTVLIFDQFEEFFSICTT
ASERQEFYDFLRDCLNFPYVKVILSLREDNLHYLLDLERRINLEAINNNILDKQIRYTLG
NFSLENAKNIIKSLTEGSQFPLEPALIEQVVKDLAVELHEVRPIELQVVGAQIQSEKIKT
LEQYWQLGVCPISILVARSLQDVILDCGYNNEDAVWSILFSLTDQRGTRPLKTWSELLSS
IPILGSPRRRATDKLEEDNKLSSNHHAFNTFPPILKRGIRAGKKKTVENPQLELILKILV
GSGLVYWVREEPEDRYQLVHDYVVEPIRQKYNSRLQFQLATKIKKNEIELVRVRKQRWRA
IALGLIMAMLAIAASEFAWRAETQRKLAQNMRTNAELIALSASSDALFVSNKNFDALMEG
LRAGIRLKQELIKSNHSILTISDLGIKTALNSWNFEQNFLPLPDKIESDTQLQVVTALEQ
AVYGIRERNHLEGHKDVVLDVSFSRDGKMIASASRDKTVRVSRPDGTLLSILIGHQESIT
SVAFSPDSKLIASGSWDKSIKLWRPDGSLVRTIKTNQGNIYRVNFSPDGKLIASASGDGT
IDLWTIEGKLLNSWVGHKGIVTWVSFSPDSNVIVSASEDTTVKLWSPAGKLLKTLTGHGG
KVNSVSFSSNGKLLASASDDKTVKVWSLNSTNFRKNSLKTQLLDTLKGHKNWVLGVSFSP
NSQVIASVGEDNTVRLWNSNGQALKVMQGHSDSVTGVAFSPDGETIASGSYDKTVKLWRR
TGNSHTVLRGHTNALNDVNFSADNQMIATASRDKTIKLWQRDGTLIATLKGHKDRVYSVN
FNPNSQILASASKDKTIKLWSRQGTLIKTLIGHGDAVLDVKFSPNGQMIVSASRDKTIKI
WDALTGKLIKTIKGHSERVNAIAFSPDGEIFASGSDDNTVKLWTADGLLIKTLKGHNGWV
LDVSWSFDGQLLASASYDNTVKLWDRNGVEVKTMKGSTDSVAHVRFSPSGKILATTSWDN
RVQLWRLDDTLLKTLQGHRDRVSTMNFSLDGKVLASGSHDKTVVLWNLDLDDLLKRSCAW
LGDYLKNNPKVKDSDRHLCN
Download sequence
Identical sequences K9VT27
WP_015201367.1.21814 gi|428303908|ref|YP_007140733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]