SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428304005|ref|YP_007140830.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428304005|ref|YP_007140830.1|
Domain Number - Region: 140-177
Classification Level Classification E-value
Superfamily TPR-like 0.0727
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428304005|ref|YP_007140830.1|
Sequence length 681
Comment hypothetical protein Cri9333_0338 [Crinalium epipsammum PCC 9333]
Sequence
MPQVSGKQKKSSSSVVNIFSKATNSKYIPSTEAIPKKQFQESKWQLPWQVWIALTLIVSG
GLSFIGVSLLLKLPSAPNCPKLFMPTASASLRLYCAELAANKQTVDNLLEAIELINNLPE
DHPLHSEIERRIEKWSLDILELANNSFQEGKLDEAIAAAKKIPEHPKITPMAIAKIKEWQ
LIWSTAQKIYDTAINYIKSLKWSEVFPEAVKLTKLGNEYWGNIKYNQLIDILQLTQKENE
QLDIGFDLVSQGGVENLYKAIKIAQSIPPTSLIFKKSAELITKSGTILVRIAKNKLNSGE
WKEALEIAKNIPPEPTLEAEAKDIIDLASAVGRANEGEVGDLEAAIAMARQLKSERPLFE
QAQKLIFKWTLEITDVQHLTEGRDLAAPGSINDLLAGIDEINKIPLNNPRYGEAQRQAYK
WRQQIQSIEDQPILDDANALAAGNKTEDLLAAIDTAKQISPGRALYPTASKQVREWSSIV
ETLQDRPILEQAQSYARSNNVDNLRTAISIARQITKGRALYGEASSQIATWKNIIRQLLV
APTASNSTESQEIAQDSNSNIEITETETRLPTKQRSAPNPVQNENVDATASSNLQNAYSL
ANGGTAESLSRAIRAASSIPTSSGDRAEATEAINNWSDQLYAIAQSQADSNVKLAIATAK
KIPKSAEIYPTVKLQIAEWGK
Download sequence
Identical sequences K9VVW9
gi|428304005|ref|YP_007140830.1| WP_015201461.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]