SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428304110|ref|YP_007140935.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428304110|ref|YP_007140935.1|
Domain Number - Region: 9-62
Classification Level Classification E-value
Superfamily TPR-like 0.0307
Family Transcription factor MalT domain III 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428304110|ref|YP_007140935.1|
Sequence length 67
Comment hypothetical protein Cri9333_0458 [Crinalium epipsammum PCC 9333]
Sequence
MSQDGKTYIEAALSMQQAAEAFFKAVEEHEEAFWAVQQFEDVPLVPGVENRTWQLWDFVM
QMSAPKK
Download sequence
Identical sequences K9VW85
WP_015201564.1.21814 gi|428304110|ref|YP_007140935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]