SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428304227|ref|YP_007141052.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428304227|ref|YP_007141052.1|
Domain Number 1 Region: 65-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-45
Family Protein kinases, catalytic subunit 0.00056
Further Details:      
 
Domain Number 2 Region: 340-410,451-488
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000249
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428304227|ref|YP_007141052.1|
Sequence length 543
Comment serine/threonine protein kinase [Crinalium epipsammum PCC 9333]
Sequence
MSYCINPKCQQRENSDNLSHCQSCGSELLINQRYRIVKPLRELNPAFPTDIFEVIDLGLG
EDDWGARKVLKVLKYSNNPALVRLFQQEARVLMFLQHSGIPKVEPDGYFTVQLPKSGKQL
YCLVMEFIEGENLADWIDKHGGISPEFVLVWLSELTNILDGLHSQNLLHRDIKPSNLLVR
PNGQLALIDFGIVGVGEWGLTKVGTTGYAAPEQIVGEAVIPSDFFALGRTFVHLLTGRSP
MDFPEDPKTGRLIWRSSVKGISQELADLIDDLMAAFPEKRPKNTRVILQRLQLIKSPADS
SKLFDRKWILNSAKWGLVGALVVIFLAPYIFRVVNQFIIPGLDKFFTNLGTDHYNNSQFS
SAESYYELALKFNPNNQAAEYSLGKICEEKKDFDCAISRYQDVINGSNSDAGAAAISSLA
RLQILSEDAKTVNVDLIFKGFKLTSQPGIQASLYKNLGWLRWEQNRIQEAEGYLKRAIAI
SQTNEYNYASPYCLLAQVKEAQKADASQEWDICYQDASSSILEEQVWASMARQRLRASGK
HVE
Download sequence
Identical sequences K9VVP0
WP_015201676.1.21814 gi|428304227|ref|YP_007141052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]