SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428304325|ref|YP_007141150.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428304325|ref|YP_007141150.1|
Domain Number 1 Region: 900-1088
Classification Level Classification E-value
Superfamily TPR-like 7.21e-17
Family Tetratricopeptide repeat (TPR) 0.0096
Further Details:      
 
Domain Number 2 Region: 315-500
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000118
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 3 Region: 196-351
Classification Level Classification E-value
Superfamily TPR-like 0.000000000043
Family Tetratricopeptide repeat (TPR) 0.008
Further Details:      
 
Domain Number 4 Region: 732-894
Classification Level Classification E-value
Superfamily TPR-like 0.00000000201
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428304325|ref|YP_007141150.1|
Sequence length 1607
Comment hypothetical protein Cri9333_0708 [Crinalium epipsammum PCC 9333]
Sequence
MAQRSEDYYRLIHHLLTCRDGEESKILMANPDLIDDGLIEALKQVSSMMAQQGNQNLADY
LIDIAKEVPNTPFFRSVTSATGAKSSASPRVKDLQLPPLLDEIFKTMGESQGNPQVVYRL
LQANKDKLNDNFVEQYHQWAVSSLHNADPDTAEMLATLIIGFSSLMYQSPLGNRDINLEI
AITGYEVVANIFTREAFPQKWAESQLNLAPAYRHRIRGNRADNQEKAIAACNNGLLIYTR
ETCLDKWATLQNNLGLVYTDRITEDKAENLEKSISCYETALKIVNRTQLPELWGTLQNNL
GNAYLFRIQGDEAQNLDHAIACYQVALQVRTRSASPYYWASSQHNLATAYEQRILGNKQQ
NLEKAISAYINALEVYTISDYPERWAGTKSSLGNAYYATDKFTEAIDCLRAALQFFTSTN
FPRECIRTGLILGKTALAAGMKAEAFEGYSVAIEAAEQIRHWGGISNAQEIPEEIQAYTN
MVVFCITNGEQDKAREYAERSGFQQVLSLLDDEFKKVFSNLQFLGQVLQVTAENPGESQI
VYQLLENNIHQLNEEFVEQLQAIEYGWRDLTSGQSIQIAATLLSFSDLIQQFSIGEQATN
LRIAATGYEVATAVFTKKDFPEQWGNIQDRIRRIFLFQLFEVLSKNQQNSECIYQLLEAN
KHKLDERFATILRLNTEAILSEVPPEGAKSIATILFYLSSLIQEFQQGNQANNLEISITG
HEVAAKVLQNEDSPEAWCLCQSMLGNAYHRRIKGERAENLEKSLFYLHKALQVPTHEQFP
QLWAEIQSNLVIAYSYRIRGDQAENLELAIKAGEAAMQVYTRDKYPEGWGKIQNNLGIVY
RDRILGNKAENLEKAIAHYQNSLLVRTREDFPELWAQTQMNLASAYRNRRLGDAAENVEM
AIAANTSALQVYRKEAFPENWAGVQMNLANAYLHRIHGDENENLQKAIAAHQSALKVLTK
DEFPYSWAMTHLNLGNVFLAQDQTEAAITCYRSALKIFTPIAFPAECLKAGQMLGNTTFM
LSDWAEVIKGYSVAIEAVENSRSWASSETRRQEILADSIHIYQYMVQACINNKHPSKAVE
YVERSRSKRLVDLMASNDLYSDGEIPPEIQQYLQDFEAIQRQIDNEIHYNSGNLDGNELG
KSGHNRAAIAPDSETIANLEANKQQIWEQIRRLDPVLAGQIQVIPMNLSSIQQLIKLPTT
AILSFYITLFDTHIFVIRQNQINLHTCTGLGFEILQASILTPWLEQYLNKQDTWKEQLPL
LAAKLAEFLKLNNLIAQHLKSIEELIIIPHIGLHQIPFSALPIAENQYLGDKFLIRYVPS
CQILEFCHNRSTSGSYLDYGIVEDATEDLPYASWEGEQLATLYDIPNHLHLKGNQQASVS
NYRNLLQKVQVIHSSHHAQSRLDNPLESALILADGCITLSQLLTPSWRIPQLEEVFLSCC
ETGLGVAEITDDILTLSTGFLCVGARSVISTLWAVDDLATALFSLFYYQYRHQGNHRLES
IKKAQFELRTITGETLAIVYKPKLSDFLTQKLKETDTLRKEAKKERDIHPHDSSMYQQVE
QEYKKHDQVGKQIYQAKRNLDSFCQESKPFSHPFYWAAFTCSGLNSI
Download sequence
Identical sequences K9VWV6
gi|428304325|ref|YP_007141150.1| WP_015201762.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]