SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428304751|ref|YP_007141576.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428304751|ref|YP_007141576.1|
Domain Number 1 Region: 234-393
Classification Level Classification E-value
Superfamily TPR-like 7.59e-21
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 2 Region: 150-261
Classification Level Classification E-value
Superfamily TPR-like 0.000000000254
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428304751|ref|YP_007141576.1|
Sequence length 405
Comment hypothetical protein Cri9333_1161 [Crinalium epipsammum PCC 9333]
Sequence
MEAWYRQDHTSRLKFLKAAIATALLLLCGNSRVLADNPQPPPNPLEITTPDPLLPKNQPL
NEQELLQFKASLDELNNQATTKLRSGNKLAAYDLWHRELRLRQQLGALEELAALGRVGGI
AWGDNQKAEVKLITQRLQAIQQQAQTQVPLNLDLLQSLGQAYQQVRVIAPAIDVYQIILT
ASQQQQNQPKVVEALSSLAELYLNWFDYPKAAENYEKLLKLSQNQVDVRNQLIHLQQLAN
VYDKVKQPENSIRIKQQLIAIYLQQQTVDKLPAVKMAIASDYEAINQPDEASQNYQEAYQ
LAISQQQFADASTALDKLGALYYSHNHPDAALQIYQTLLEVEQQSNDFYGLMNTYDHIGQ
IYFAQRNFEQAKAAFQQGLDLANSLKYQQDYFASQIERVNQQKSP
Download sequence
Identical sequences K9VVT8
WP_015202188.1.21814 gi|428304751|ref|YP_007141576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]