SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428304780|ref|YP_007141605.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428304780|ref|YP_007141605.1|
Domain Number 1 Region: 686-986
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 4.45e-68
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000186
Further Details:      
 
Domain Number 2 Region: 10-76
Classification Level Classification E-value
Superfamily TPR-like 0.00000469
Family Tetratricopeptide repeat (TPR) 0.078
Further Details:      
 
Weak hits

Sequence:  gi|428304780|ref|YP_007141605.1|
Domain Number - Region: 600-637
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000353
Family HAMP domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428304780|ref|YP_007141605.1|
Sequence length 991
Comment methyl-accepting chemotaxis sensory transducer [Crinalium epipsammum PCC 9333]
Sequence
MTSSTDYAQEYQQAEKAYLQGNYNQAAEIVDQLVQKLPDDPSSHLLRGHIYCYGLQQYDV
AEQQYDLVKTLTSEPEFLEYANNGLEYARACSTSADYAEQGGAIEEAPAHQNYTDEDANL
AESSFTPYSEELETGYLGEFDLGEINFDDDSEQNFDQYGSSDHFSNPFNNRLDESPESSH
IQEDFLDPFAFGQSPNNDSAIPSTGTDFNFNPIEESNDFFPMDAFADLDDDADGGETLFL
NPPDAPNGKGFIITPADTLDTTPDPTDAFHQDDLGNSYDFESHVDPNATDYGNSNGNYSN
APPSNHFPSERPVYEDETLLMRAEDLENTFAAPSGNFATDYQPGSEDTNLFVVDEYDSEE
ATQHFSSAQNGFTPPEAFDFDAFDEAFASDVDDPVSGFGDSTAIPAHQTQAGFLDAFDDF
DDFGSISDFDPAGQDGLDLSAGFGRSDTRGFSSTNTTGGLGATVPSKIGGDEDEIFSITS
TSGIGSGKGENLPSFTQSSAGHVEPNVTVDQSWLAPFENAPLNKKNLITAAAAGIVSAVA
VATVSFMAGTTAPKASQATLIPQLRNTSVLMTLAAGFASFGTTLFLGRVATKQLSRSTSN
LQAQFEEICQGNLNARATVYSEDDFGRLATGFNQMGHVMMTTIGELQRKAIELEQAKEDL
QRQVIRLLDDVEGAARGDLTVQAEVTADVLGAVADSFNLTIQNLRQIVQQVKVAAKQVNK
GSKDSEVFARNLSSDALRQAEELAVTLNSVQVMTDSIKRVADSAKEAEEVARTASATALK
GGEAVERTVAGILEIRETVAETTRKVKRLAESSQEISKIVALISQIASRTNLLALNASIE
AARAGEAGRGFAIVADEVRQLADRSAKALKEIEQIVLQIQSETGSVMTAMEEGTQQVIQG
TRLAEQAKRSLDDIIQVSNRIDALVRSITADTVEQTETSQSVAHVMQSVELTAQETSQEA
QRVSGALGNLHGVAQDLLNSVERFKVDADGK
Download sequence
Identical sequences K9VY77
gi|428304780|ref|YP_007141605.1| WP_015202217.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]