SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428305082|ref|YP_007141907.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428305082|ref|YP_007141907.1|
Domain Number 1 Region: 90-252
Classification Level Classification E-value
Superfamily TPR-like 0.00000000122
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Domain Number 2 Region: 287-414
Classification Level Classification E-value
Superfamily TPR-like 0.000000142
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428305082|ref|YP_007141907.1|
Sequence length 444
Comment hypothetical protein Cri9333_1505 [Crinalium epipsammum PCC 9333]
Sequence
MKKSFSCFKIACLELILLVGSCAATPKIEQLLAQQRQVTPNVQNSTKKSLQTEPKLRGIP
LACYVRVGPLGFLPSSASSSASMLAADQSTEWAEIALAYAKAKQFPSAIATTKKMDNYHY
IKDTILVEIGGMYAAAGQYTKAKQLVNSIERGDDKSQLLARIASKYAKAGKPQQASQTFM
QALRLTRTLDAKLMRDGAIAAIAIEYASAGQYKQALQLTKTIKDQSDKPQALAGIVTQYA
LTGQFDQALNLAKTIGDNYYKSQALESIAESAKVSQLAQLTQVTQTIKDDTYKAVSLAKI
ARRYVALGNFDQAAKLTQMVDAINPYGDAMLPDIIADYVTAGKFDQALQLANSMKDEYWQ
GETMVKIAQKYAAAGKFEEAVRLADSINSVESKTQALKAIASEYAKTGQYDRALALVGTV
PPAATEAYEAIQAQFIPLLKCAKT
Download sequence
Identical sequences K9VY08
gi|428305082|ref|YP_007141907.1| WP_015202518.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]