SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428305174|ref|YP_007141999.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428305174|ref|YP_007141999.1|
Domain Number 1 Region: 2-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-54
Family Protein kinases, catalytic subunit 0.0000823
Further Details:      
 
Domain Number 2 Region: 1626-1804
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-39
Family Histidine kinase 0.0018
Further Details:      
 
Domain Number 3 Region: 1314-1497
Classification Level Classification E-value
Superfamily GAF domain-like 8.07e-28
Family GAF domain 0.0036
Further Details:      
 
Domain Number 4 Region: 292-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.4e-20
Family G proteins 0.094
Further Details:      
 
Domain Number 5 Region: 1537-1577,1607-1638
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000255
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 
Weak hits

Sequence:  gi|428305174|ref|YP_007141999.1|
Domain Number - Region: 755-864
Classification Level Classification E-value
Superfamily TPR-like 0.0104
Family BTAD-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428305174|ref|YP_007141999.1|
Sequence length 1806
Comment multi-sensor signal transduction multi-kinase [Crinalium epipsammum PCC 9333]
Sequence
MIAISGYKIIEKIYDGVETGVYRAQPDLEENTVIIKILKAKYPTLKEITQLRHEYDISKN
LDFAGIIKTYKLENYQNGLFLVLEDLGGLDLKKFLDTHKIDLKDFCEIALQLTDALTVLY
EHHIIHKDIKPHNIIIQPITKQVKITDFSIASRLSRENPTINNPNGMEGTLTYISPEQTG
RMNRSIDYRTDFYSLGVTFYEMLTGEVPFKSSEPIELVHAHIAKKPIPPIELNPEIPQVI
SDIVMKLLAKTAEDRYQSALGIKADLEICLNELQNTGSISNFTPGQEDLFAQFVIPQKLY
GRETEVATLMAAFERASQGSAEMMLVSGYSGIGKSSLVNEVHKPIVRDRGYFISGKFDQF
KRNIPYASVIEAFQDLIRQLLTETSAKIANWKEKLLNALGENGQVITEVLPDVELIIGEQ
PDVPKLGATESQNRFNRVFQNFSHVFSTKEHPLVLFLDDLQWADSASLKLIQLLITDPDS
QYLLFIGAYRDNEVSPTHPLILTLEEIQKLGSTINNIVLTPLDISHVRELVADTLHDQIN
RSQPLANLVFNKTQGNPFFLTQLLQSLYEEKLLTFDFNVGNWQWNIEQIQGIGITDYSVV
QLLAKNIQKLPKSTQRVLKLAACIGNTFNLDVLAIINEKSQPETAEDLWSSLQAGLILPL
NEAYKIPLSFDENKSGALILQDFKVSYKFLHDRVQQAAYSLIPEAEKKETHLKIGQLLLE
KTNPEERKENIFALVNQLNFGTELITSDAEKYELVELNLIAGIRAKLSNAYEAARKYLNV
ALALIPENSWQNQYELALALYVEAVEVEYLNIDFEQAEKLSEIVITQAKDLLDKIQVYEY
KILFYLAQSQPNVAIELSLQVLEMLNITLAETPPEKLNIEDLVKLPEMQDPHKLAAMRIL
MVLMPAAAFVNPALLPASAFTMVNLSSQHGNSALAAYSYATYALLLCQFLGDIEAGYKFS
QLSLKILEDFNGKKIKAKIFNIVNGFVIHWKAHARETVEPLREGVQVGIETGDIEYACYN
AATYSAYIFYIGEPLNFVNQQQSIYVDMMLKLQQKTQVEYAQIFRQLVFCLSKEVTNKYS
LCGDFFNTAEMLPIFIGNKNFLLVFVTYLANTLISYWFKNYEQAVTNAMQATQYAFAASG
FIHITEHNFYYSLALLGAYPDVENSLQQQYMQQVENNQQAMQLWAENAPANYQHKYDLIN
AEKARILGNIGEAMEYYDRAIKAAKKQQYTQEEGLANELAAEFYFSRGKDKVATTYLTDA
YYCYIHWEATAKVKDLELRYPQIFSQILARKNFSIDLDKTTSLTTAVGTFALDLTTVMKA
SQTLSREILLNDLIEKLMKIVMENAGAQNSCLILDKKGKLVVEATVFVDKNDLVLFPSIP
LEDSETLPLSLINYVARTQENVVLRDAGREGNFITDAYIVKAKLKSILCVPIINQGTVIG
ILYLENNLTAGAFTPERLEVLRILSTQAAISLKNAMLYANLETATEELKVANTKLEEYSR
TLEQKVETRTLELKDKNLRLEQTLTELQQTQTQLIQTEKMSSLGQLVAGIAHEINNPVNF
IHGNILHASEYIDGLLNLVNLYQEQYPNSTPKIQDEIEAIDLEFLREDLPKVIESMQIGS
ERIRQIVLSLRNFSRLDEAEMKKVDIHEGIDSTLLILQHRLKAKSEHSEIKIIKEYGDLP
KVECYPGQLNQVFMNIVSNAIDVLEEYDSKRSGLERQQNPCTIRIHTHLIDGNKVKISIA
DNGSGMREEVRSKIFDPFFTTKSVGSGTGLGLSISYQIVVEKHRGHLECISSPGKGAEFI
ITIPTS
Download sequence
Identical sequences K9VY61
WP_015202610.1.21814 gi|428305174|ref|YP_007141999.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]