SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428305344|ref|YP_007142169.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428305344|ref|YP_007142169.1|
Domain Number 1 Region: 95-313
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.83e-66
Family Prokaryotic proteases 0.00000446
Further Details:      
 
Domain Number 2 Region: 303-419
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-24
Family HtrA-like serine proteases 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428305344|ref|YP_007142169.1|
Sequence length 429
Comment HtrA2 peptidase [Crinalium epipsammum PCC 9333]
Sequence
MPNQQRDLNRNSEPINPISSNASDLPSHKAASTAWRKGATYLSLILLGAGASLTGSYLAS
NNQQALEASKSYITPAAVAQTAPIPQPNRTQGNFVTDVVDRVGPAVVRINASRTVTSQLP
EAFNDPFFRRFFGSRVPTEPDSRVERGTGSGFIISSNGQILTNAHVVAGADTVSVTLKDG
RTMEGKVLGVDPVTDVAVIKINGSNLPAVRLGNSEQLKPGEWAIAIGNPLGLDNTVTTGI
ISATGRTSSQVGVPDKRVSFIQTDAAINPGNSGGPLLNASGQVIGMNTAIIQGAQGIGFA
IPINTAQRIATQLATTGKVEHAYLGIQMVNLTPELKQSINSNANSGLNVDQDRGILVVRV
MPNSPAAKAGLRPGDVIKQINGKSVTDAASLQQVVENSNLGSNLQLALRRNGRDLSMNVR
TGALPAQAS
Download sequence
Identical sequences K9VYP4
WP_015202777.1.21814 gi|428305344|ref|YP_007142169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]