SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428305369|ref|YP_007142194.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428305369|ref|YP_007142194.1|
Domain Number 1 Region: 54-246
Classification Level Classification E-value
Superfamily TPR-like 2.4e-39
Family Tetratricopeptide repeat (TPR) 0.0031
Further Details:      
 
Weak hits

Sequence:  gi|428305369|ref|YP_007142194.1|
Domain Number - Region: 2-56
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.0301
Family ATP-dependent DNA ligase DNA-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428305369|ref|YP_007142194.1|
Sequence length 273
Comment hypothetical protein Cri9333_1799 [Crinalium epipsammum PCC 9333]
Sequence
MIRWILNLLSIVLVVLMGLIYVPAVMAQTQDAPQFTESELQVGDELAAKAINAGNSGNFA
TAEQNWTELIEKFPSNPAIWSNRGNVRVSQNKLEDAIADYNKAIELAPNATDPYLNRGTA
YEGLGRWQEAIADYNRVLELDAKDAMAYNNRGNAEAGLEKWESAIADYQKSAELAPNFAI
ARANYAIALYQIGQTTEAIRTMRNIIRKYPQFPDVRAALTAALWEQGKQGEAESHWVAAV
GLDLRYKNLDWVKNVRRWPPVMVAALEKFIKLQ
Download sequence
Identical sequences K9VYR7
gi|428305369|ref|YP_007142194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]