SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428305658|ref|YP_007142483.1| from Crinalium epipsammum PCC 9333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428305658|ref|YP_007142483.1|
Domain Number 1 Region: 123-457
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.61e-55
Family L-arabinose binding protein-like 0.00042
Further Details:      
 
Weak hits

Sequence:  gi|428305658|ref|YP_007142483.1|
Domain Number - Region: 78-119
Classification Level Classification E-value
Superfamily TPR-like 0.00104
Family Tetratricopeptide repeat (TPR) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428305658|ref|YP_007142483.1|
Sequence length 470
Comment amino acid ABC transporter substrate-binding protein [Crinalium epipsammum PCC 9333]
Sequence
MSQKKETTVLVLSLIITLAAVSAGFWWLTNNSGIKLGNLFKTDSSISEPNKDKSVEDRIS
LGDKILISGISSPPKQAGVEAIASKNYQSAIANFQAAIKVNRNDPEALIFLNNARIENKK
SYTIAVLVPIGSDVNSSLEMLRGVAQAQNEINSSGGVKGVSLKVAIANDENNPEIAKKIA
TTLVQNSEVLGVVGAYASDVTLAAGSVFQSGQLVAISPTSTSVKLSSFGSYIFRTVPSDY
VAARALANYMVTKLKQQNVAVFFNSKSSYSQSLKSEFVTAVSLSGGQVKSEFDLSQPNFS
AAKSIEQATKQQVKVLMLASNTDTLDKALQVVQINRKQLALLAGDDAYTPKTLEVGGESA
VGMVVAVPWHIDAQPNSVFARTSRSLWDGATVNWRTALAYDATEALIKAIERNPTRTGIQ
QALSSPDFSPTGASGSIGFLASGDRNSSVQLVKIVPGNRSGTGYDFVPVP
Download sequence
Identical sequences K9VXY0
gi|428305658|ref|YP_007142483.1| WP_015203089.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]